SecReT6
Protein ID: 389875333
SecReT6 ID665
T6SS typei5
Gene symbol-
Locus tagTMO_a0081
StrainTistrella mobilis KA081020-065
Repliconplasmid pTM1 [GenBank: NC_017957] [Browse all T6SS(s) in this replicon]
Location [Strand]85211..86617 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDI3TRU6
KEGG IDtmo:TMO_a0081
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 8.10E-15, Aligned region: 29..94
FHA [PF00498], Evalue: 8.10E-15, Aligned region: 420..430
Protein Sequence: 468 a.a.     [Download]
>gi|389875333|ref|YP_006373068.1| FHA domain-containing protein [Tistrella mobilis KA081020-065]
MRLVIDIAHRDDPATRIGPSRSFDRRGLRVGRGPANDVVLEDPTRVISGQHCLIDYDSGRFRLIDTSTNG
SFVNDPRRPVPRETGHVVADGDRVFVGDYVLTLGLMPVPDEAPAPRPARPLHAAPKPVQRPDPGAAFSGG
EPPATAFAFTPPRVARVEIPEDWDADGQNLDGLMAAPENDPSDPPAPPIRRPPQPPSQPPRPPRDPDPIP
VEDPEDVPLEDPVPIRDPEPLPDPDPDEDPEPYRDPPPRQTPPPSEYRLRDDRLYDAFLSGAGLTREQLP
PSRAEEVLRTAGEVFRATARGLIETLSARAELKGEFRIERTTIKPRNNNPLKFSATPEEAMLAFLQPTLP
AFSSGVKAVEQGFDDIAAHQIAMVRGLEAGLGVVIDTLSPEATERAVGHVGGLGAIVSTARKAALWDGYR
RRHAEIRSRAEEDARSLFAEGFARGYATSHAALPMQRATPAEGGEARR
 
Nucleotide Sequence: 1407 bp     [Download]
>gi|442559580|ref|NC_017957.2|:c86617-85211 Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence
ATGCGGCTCGTGATCGACATCGCCCATCGCGACGATCCGGCAACCCGGATCGGGCCCTCGCGGAGCTTCG
ACCGCCGCGGCCTGCGTGTCGGTCGCGGCCCGGCCAACGACGTGGTGCTGGAAGATCCGACCCGGGTGAT
TTCCGGCCAGCACTGCCTGATCGACTATGACAGCGGCCGGTTCCGGCTGATCGACACCAGCACCAACGGC
AGTTTCGTGAACGATCCGCGCCGGCCGGTGCCGCGCGAGACCGGCCATGTGGTGGCCGATGGCGACCGGG
TGTTCGTTGGCGATTACGTGCTGACGCTGGGGCTGATGCCGGTGCCGGACGAGGCGCCGGCACCCCGGCC
GGCCCGGCCGCTGCATGCGGCACCGAAGCCGGTGCAGCGCCCTGATCCGGGGGCGGCCTTCTCGGGCGGC
GAGCCGCCGGCCACCGCCTTCGCCTTCACCCCGCCCCGCGTCGCCCGGGTCGAGATCCCGGAAGACTGGG
ATGCCGACGGCCAGAACCTGGACGGGCTGATGGCGGCCCCTGAGAACGACCCCTCGGACCCGCCGGCCCC
GCCGATCCGCCGCCCGCCCCAACCGCCGAGCCAACCACCCCGGCCGCCGCGCGACCCCGACCCGATCCCG
GTCGAGGACCCGGAAGACGTGCCGCTGGAGGATCCGGTGCCGATCCGCGACCCCGAGCCGCTGCCCGATC
CGGACCCGGACGAGGACCCCGAACCCTATCGCGACCCGCCGCCGCGCCAGACCCCGCCGCCGTCGGAATA
CCGGCTGCGTGACGACCGGCTCTACGATGCCTTCCTGTCGGGCGCCGGGCTGACCCGCGAGCAGCTGCCG
CCTTCCCGCGCCGAAGAGGTGCTGCGGACCGCGGGCGAGGTGTTCCGGGCGACGGCCCGCGGGCTGATCG
AGACCCTGTCGGCCCGGGCCGAGCTGAAGGGCGAATTCCGCATCGAGCGCACCACCATCAAGCCGCGCAA
CAACAACCCGCTGAAATTCTCGGCGACGCCCGAAGAGGCGATGCTGGCCTTCCTGCAGCCGACCCTGCCG
GCCTTCTCGTCGGGGGTGAAGGCGGTGGAACAGGGCTTCGACGACATCGCCGCCCACCAGATCGCCATGG
TGCGCGGGCTGGAAGCGGGGCTGGGCGTGGTCATCGACACCCTGTCGCCCGAGGCGACCGAACGCGCGGT
CGGCCATGTCGGCGGGCTGGGCGCCATCGTCTCCACCGCCCGCAAGGCCGCACTCTGGGACGGCTATCGC
CGCCGCCATGCCGAGATCCGCAGCCGCGCCGAGGAGGATGCGCGGTCGCTGTTCGCCGAAGGCTTCGCCC
GCGGCTATGCCACCTCTCACGCTGCCCTCCCGATGCAGCGCGCGACACCGGCGGAGGGCGGGGAGGCCCG
GCGATGA