SecReT6
Protein ID: 389875334
SecReT6 ID665
T6SS typei5
Gene symbol-
Locus tagTMO_a0082
StrainTistrella mobilis KA081020-065
Repliconplasmid pTM1 [GenBank: NC_017957] [Browse all T6SS(s) in this replicon]
Location [Strand]86661..89264 [-]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDI3TRU7
KEGG IDtmo:TMO_a0082
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 7.20E-41, Aligned region: 225..245
AAA_2 [PF07724], Evalue: 7.20E-41, Aligned region: 597..763
AAA [PF00004], Evalue: 1.90E-18, Aligned region: 225..357
AAA [PF00004], Evalue: 1.90E-18, Aligned region: 603..726
AAA_5 [PF07728], Evalue: 1.30E-12, Aligned region: 225..244
AAA_5 [PF07728], Evalue: 1.30E-12, Aligned region: 299..355
AAA_5 [PF07728], Evalue: 1.30E-12, Aligned region: 603..723
AAA_16 [PF13191], Evalue: 2.30E-10, Aligned region: 118..156
AAA_16 [PF13191], Evalue: 2.30E-10, Aligned region: 202..242
AAA_16 [PF13191], Evalue: 2.30E-10, Aligned region: 269..303
AAA_16 [PF13191], Evalue: 2.30E-10, Aligned region: 455..455
AAA_16 [PF13191], Evalue: 2.30E-10, Aligned region: 571..635
AAA_16 [PF13191], Evalue: 2.30E-10, Aligned region: 668..697
Sigma54_activat [PF00158], Evalue: 7.30E-09, Aligned region: 208..241
Sigma54_activat [PF00158], Evalue: 7.30E-09, Aligned region: 602..722
AAA_22 [PF13401], Evalue: 1.30E-08, Aligned region: 224..306
AAA_22 [PF13401], Evalue: 1.30E-08, Aligned region: 341..389
AAA_22 [PF13401], Evalue: 1.30E-08, Aligned region: 599..634
ClpB_D2-small [PF10431], Evalue: 1.60E-08, Aligned region: 770..847
Clp_N [PF02861], Evalue: 9.50E-08, Aligned region: 28..72
Clp_N [PF02861], Evalue: 9.50E-08, Aligned region: 112..129
AAA_18 [PF13238], Evalue: 3.60E-05, Aligned region: 225..244
AAA_18 [PF13238], Evalue: 3.60E-05, Aligned region: 604..638
AAA_17 [PF13207], Evalue: 0.00016, Aligned region: 225..245
AAA_17 [PF13207], Evalue: 0.00016, Aligned region: 513..524
AAA_17 [PF13207], Evalue: 0.00016, Aligned region: 602..637
Arch_ATPase [PF01637], Evalue: 0.00019, Aligned region: 204..239
Arch_ATPase [PF01637], Evalue: 0.00019, Aligned region: 278..396
Arch_ATPase [PF01637], Evalue: 0.00019, Aligned region: 601..644
IstB_IS21 [PF01695], Evalue: 0.0011, Aligned region: 219..263
IstB_IS21 [PF01695], Evalue: 0.0011, Aligned region: 602..620
IstB_IS21 [PF01695], Evalue: 0.0011, Aligned region: 715..735
AAA_29 [PF13555], Evalue: 0.0013, Aligned region: 219..241
AAA_29 [PF13555], Evalue: 0.0013, Aligned region: 598..627
NACHT [PF05729], Evalue: 0.0015, Aligned region: 225..252
NACHT [PF05729], Evalue: 0.0015, Aligned region: 603..624
AAA_19 [PF13245], Evalue: 0.0034, Aligned region: 225..247
AAA_19 [PF13245], Evalue: 0.0034, Aligned region: 598..624
AAA_25 [PF13481], Evalue: 0.004, Aligned region: 225..249
AAA_25 [PF13481], Evalue: 0.004, Aligned region: 281..321
AAA_25 [PF13481], Evalue: 0.004, Aligned region: 444..485
AAA_25 [PF13481], Evalue: 0.004, Aligned region: 592..620
Zeta_toxin [PF06414], Evalue: 0.0043, Aligned region: 219..245
Zeta_toxin [PF06414], Evalue: 0.0043, Aligned region: 596..643
AAA_34 [PF13872], Evalue: 0.0067, Aligned region: 273..340
AAA_34 [PF13872], Evalue: 0.0067, Aligned region: 561..632
T2SE [PF00437], Evalue: 0.0096, Aligned region: 210..241
T2SE [PF00437], Evalue: 0.0096, Aligned region: 598..680
Protein Sequence: 867 a.a.     [Download]
>gi|389875334|ref|YP_006373069.1| type VI secretion ATPase, ClpV1 family [Tistrella mobilis KA081020-065]
MATTQIRSLVDKLNRTCRKALEAAAGNAVNRGNHAIEIEHWLRALVADDGAVLPRALAEAGVAVPRALTA
LDGALDRLRSGNDRAPALAPGLIAMIRQAWTVASIESGADRIASGHLLVAALRDELASQQLAQVIPVLGR
LSADQVLERLPELADGSDEAGEAGSGPAAAEAPLSSLQSGKALATYAIDLTEAARAGRLDPVLGRDDEIA
QVIDILSRRRQNNPILTGEAGVGKTAVVEGLALRVAAGEVPAALARARLLTLDLGLLQAGAGVKGEFENR
LKSVIDEVKASADPVILFIDEAHTLIGAGGAAGQGDAANLLKPALARGELRTIAATTWAEYKRHVERDPA
LARRFQVVKVEEPSEARAVTMLRGLVEKLEAHHGVHIHDAAVEEAVRLSARYLPERQLPDKAVSVLDTAA
ARVAMGRAVVPPALQKLRAEHAALERARDMRLRDAALGGAALSVDTMIVDLANLETQIAEMAKRHTEETR
LVGELAEARAVAEPEARAAAQSAVLEQLKVVQGKDPLLPVDVDARAVAAVISDWTGIPLGRMADDELETV
RRLEDRLRTRIIGQDHALEAVARAVRTRRAGLDDPRRPAGVFLFAGTSGVGKTETAVALAELLHGDARAL
TVINLSEFKEEHKVSMLLGAPPGYVGYGEGGVLTEAVRRRPHGVVLLDEIEKAHPGVQDVFYRIFDEGRV
RDGEGREIDFRNVTLILTTNAGSETITKLMDDPDTAPGPEGLAEALEPVLRQSFKPAFLGRLKLVPFMPL
DDERLLAIVNLQLDRAVRRITETYDLPVTVAPEVAPAVLARARARDAGARAVEAVISGELMPGLAGLILD
RLAEEGAPPRAVEIATGPDGSLTPRLS
 
Nucleotide Sequence: 2604 bp     [Download]
>gi|442559580|ref|NC_017957.2|:c89264-86661 Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence
ATGGCCACCACCCAGATCCGTTCCCTGGTCGACAAGCTGAACCGGACCTGCCGCAAGGCGCTCGAAGCCG
CGGCGGGCAATGCCGTCAATCGCGGCAATCACGCGATCGAGATCGAACACTGGCTGCGCGCCCTGGTCGC
CGATGACGGCGCAGTGCTGCCCCGGGCGCTGGCGGAGGCGGGCGTCGCGGTGCCGCGGGCGCTGACCGCG
CTCGACGGTGCGCTCGACCGGCTGCGCAGCGGCAATGACCGCGCGCCGGCCCTGGCGCCGGGGCTGATCG
CCATGATCCGCCAGGCCTGGACGGTGGCCTCGATCGAGAGCGGGGCAGACCGGATCGCATCGGGCCATCT
GCTGGTGGCGGCCCTGCGCGATGAGCTGGCCTCGCAGCAGCTGGCCCAGGTGATCCCGGTTCTGGGGCGA
CTGTCGGCCGATCAGGTTCTGGAACGGCTGCCGGAGCTGGCAGACGGCAGCGACGAGGCGGGGGAGGCGG
GCAGCGGCCCGGCCGCGGCGGAGGCGCCGCTCTCTTCGCTGCAGAGCGGCAAGGCGCTCGCCACCTATGC
GATCGACCTGACCGAGGCGGCGCGTGCGGGCCGGCTGGATCCGGTGCTGGGGCGCGATGACGAGATCGCC
CAGGTGATCGACATCCTGTCGCGGCGGCGGCAGAACAACCCGATCCTGACCGGCGAGGCCGGGGTTGGCA
AGACCGCGGTGGTCGAGGGGCTGGCTCTGCGCGTGGCGGCGGGCGAGGTGCCGGCGGCGCTGGCCCGTGC
CCGGTTGCTGACCCTGGATCTGGGCCTGTTGCAGGCAGGTGCGGGCGTGAAGGGCGAGTTCGAAAACCGG
CTGAAATCGGTGATCGACGAGGTCAAGGCCAGCGCCGACCCGGTCATCCTGTTCATCGATGAGGCGCATA
CCCTGATCGGCGCCGGCGGTGCTGCGGGGCAGGGCGATGCGGCCAATCTGCTCAAACCCGCGCTCGCCCG
CGGCGAGCTGCGCACCATCGCCGCCACCACCTGGGCGGAATACAAGCGCCATGTGGAACGCGACCCGGCG
CTGGCCCGCCGCTTCCAGGTGGTGAAGGTGGAAGAGCCGTCGGAGGCCCGGGCCGTGACCATGCTGCGCG
GGCTGGTGGAGAAGCTGGAAGCCCATCACGGGGTGCATATCCACGATGCCGCGGTGGAAGAGGCGGTGCG
GCTGTCGGCCCGCTATCTGCCGGAGCGGCAGCTGCCCGACAAGGCGGTGAGCGTGCTGGACACGGCAGCG
GCCCGGGTCGCCATGGGCCGGGCGGTGGTGCCGCCGGCATTGCAGAAACTGCGCGCGGAGCACGCCGCGC
TGGAACGGGCGCGTGACATGCGGTTGCGTGATGCGGCGCTGGGCGGCGCGGCCTTGTCGGTCGATACCAT
GATAGTCGATCTGGCTAATCTTGAGACACAAATAGCCGAAATGGCTAAGCGCCATACCGAGGAGACGCGG
CTGGTGGGTGAGCTGGCCGAGGCACGGGCGGTCGCCGAGCCGGAGGCGCGTGCGGCCGCACAATCGGCGG
TGCTTGAACAGCTAAAAGTTGTGCAAGGCAAAGATCCGCTGCTTCCGGTTGATGTTGATGCCCGGGCGGT
GGCGGCGGTGATTTCGGACTGGACCGGCATTCCGCTCGGCCGCATGGCCGATGACGAGCTGGAGACCGTG
CGCCGGCTGGAGGATCGGCTCCGCACAAGGATCATCGGCCAGGACCATGCGCTGGAGGCGGTGGCGCGGG
CGGTGCGCACCAGGCGTGCGGGGCTGGACGATCCGCGCCGGCCGGCCGGCGTGTTCCTGTTCGCCGGCAC
CTCGGGCGTGGGCAAAACAGAGACCGCGGTCGCGCTGGCCGAGCTGCTGCACGGCGATGCCCGGGCGCTG
ACCGTGATCAATCTCTCGGAATTCAAGGAGGAACATAAGGTCTCGATGCTGCTGGGCGCGCCGCCCGGCT
ATGTCGGCTATGGCGAAGGCGGGGTGCTGACCGAGGCGGTGCGCCGCCGGCCCCATGGCGTGGTTCTGCT
GGACGAGATCGAGAAGGCCCATCCGGGCGTGCAGGACGTGTTCTACCGGATCTTCGACGAAGGCCGGGTG
CGCGACGGCGAGGGGCGGGAGATCGATTTCCGTAACGTGACCCTGATTCTGACCACCAATGCCGGATCGG
AGACCATCACGAAACTGATGGACGACCCCGATACCGCACCGGGACCGGAGGGGCTTGCGGAGGCGCTGGA
ACCGGTGCTGCGGCAGAGTTTCAAGCCGGCCTTCCTTGGGCGCCTCAAACTGGTCCCATTCATGCCACTG
GATGATGAGAGGTTGCTTGCTATCGTGAACCTGCAACTCGATCGCGCAGTGCGGCGCATCACCGAAACCT
ATGATCTGCCGGTCACGGTGGCGCCCGAGGTGGCGCCGGCGGTGCTGGCCCGCGCCCGGGCACGCGATGC
CGGGGCACGCGCGGTGGAGGCGGTGATTTCCGGCGAGCTGATGCCGGGCCTGGCCGGGCTGATCCTGGAC
CGGCTGGCGGAAGAGGGCGCGCCGCCGCGTGCAGTCGAGATCGCAACCGGGCCCGATGGCAGCCTGACGC
CCCGGTTGTCGTGA