SecReT6
Protein ID: 389875335
SecReT6 ID665
T6SS typei5
Gene symbol-
Locus tagTMO_a0083
StrainTistrella mobilis KA081020-065
Repliconplasmid pTM1 [GenBank: NC_017957] [Browse all T6SS(s) in this replicon]
Location [Strand]89334..90365 [-]
Producttype VI secretion system protein ImpH
NoteTssG
UniProt IDI3TRU8
KEGG IDtmo:TMO_a0083
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.70E-82, Aligned region: 26..325
Protein Sequence: 343 a.a.     [Download]
>gi|389875335|ref|YP_006373070.1| type VI secretion system protein ImpH [Tistrella mobilis KA081020-065]
MTTMQPPRAETVPTPAPTGVLADLARAPWSFEPVQAVRVLERAAGSNPADAVRFQGVLPLAFPASAVAGA
RLGQVEGAPAVLRIAHLGLLGPSGVLPSHMTAAAIEAERRRNPGFARFVDLFLDRQGAFFHGAQVKYRMA
LAHERAAAEGREDAITGALRALTGLGTPHLAGRLAVDDLTVIRHAGHFARGPRSAAALEAMLSGQLGASV
RIRQFAGSWVRLDAAERSRLTPGGFCRLGVDMVAGEKVRDVDGRFEIVVGPLSRAHFAALLPEGAAVRAL
TDLVRLYVGPAMSFALRLVLDRREVPPAELGEAGGLRLGWTGWLTGAAPPARDPDDAVFEIGA
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|442559580|ref|NC_017957.2|:c90365-89334 Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence
ATGACGACGATGCAACCGCCCCGGGCCGAAACGGTTCCCACCCCGGCGCCCACCGGCGTCCTTGCCGATC
TTGCCCGCGCGCCCTGGTCGTTCGAGCCGGTGCAGGCGGTCAGGGTGCTGGAGCGCGCAGCCGGGAGCAA
TCCGGCCGATGCCGTGCGCTTCCAGGGCGTGCTGCCGCTGGCCTTTCCGGCAAGTGCGGTGGCCGGCGCG
CGTCTGGGCCAGGTGGAGGGGGCGCCGGCGGTGCTGCGCATCGCCCATCTGGGGCTGCTCGGCCCCTCGG
GCGTGCTGCCCTCGCATATGACCGCGGCGGCGATCGAGGCCGAGCGGCGGCGCAATCCCGGTTTCGCCCG
TTTCGTGGATCTGTTCCTCGATCGCCAGGGCGCCTTTTTCCACGGCGCCCAGGTGAAATACCGCATGGCG
CTGGCGCATGAGCGCGCGGCGGCGGAAGGCCGCGAGGATGCGATCACCGGCGCATTGCGTGCCCTGACCG
GGCTTGGCACGCCGCATCTGGCCGGGCGGCTGGCGGTCGACGATCTGACGGTGATCCGCCATGCCGGCCA
TTTCGCGCGCGGGCCGCGTTCTGCCGCCGCCCTGGAGGCGATGCTCTCCGGCCAGCTTGGCGCGTCGGTT
CGCATCCGCCAGTTCGCCGGCAGCTGGGTGCGGCTGGACGCGGCCGAGCGCAGCCGCCTGACGCCCGGCG
GCTTCTGCCGCCTGGGCGTCGACATGGTCGCGGGCGAGAAGGTCCGCGATGTCGACGGCCGCTTTGAAAT
CGTGGTCGGCCCGCTGTCGCGGGCCCATTTCGCGGCGCTGCTGCCCGAAGGTGCCGCGGTGCGCGCGCTC
ACCGATCTGGTCCGGCTTTATGTCGGTCCGGCGATGTCGTTCGCGCTCCGCCTGGTGCTGGACCGGCGCG
AGGTGCCGCCGGCCGAATTGGGCGAGGCGGGCGGGCTGCGCCTCGGTTGGACCGGCTGGCTGACCGGCGC
CGCCCCGCCCGCCCGCGACCCCGACGATGCCGTGTTCGAGATCGGCGCCTGA