SecReT6
Protein ID: 389875336
SecReT6 ID665
T6SS typei5
Gene symbol-
Locus tagTMO_a0084
StrainTistrella mobilis KA081020-065
Repliconplasmid pTM1 [GenBank: NC_017957] [Browse all T6SS(s) in this replicon]
Location [Strand]90375..92216 [-]
Producttype VI secretion system protein ImpG
NoteTssF
UniProt IDI3TRU9
KEGG IDtmo:TMO_a0084
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.40E-198, Aligned region: 5..612
Protein Sequence: 613 a.a.     [Download]
>gi|389875336|ref|YP_006373071.1| type VI secretion system protein ImpG [Tistrella mobilis KA081020-065]
MTDELLPHYQRELVEIRRRAGEFAAAHPKIAGRLRLTADAADDPFVARLIEAVAYLNARIQLRLDDAFPE
LTDALLGVLHPHWLAPVPSMAIARFTPQADLSGPHTVPAGAELVTGPVAPAEGRAPEPCRFRTAWPATLW
PVEIETVALKARPVAAPAIAGVEQAVAVLKIGLRMTQPGRSFTEIGLDRLRLFIAAPGAQAMRLYERLTN
DVAGIAVAAGPEDPRPVRLGPDAVAPVGFAGDEGLLPDDARTLPAYRLLTEYFAFPEKFLFLDLNGLDAR
TLAPTGDRLEIHVFLTRHDQDLERAVTAESFALGAVPIVNLFRQAAEPIRLDQRQSAYRVVPDARRPLST
EIFRILRVEGSDSGGRRQLYQPFHSVAHGTAMADETRRWWHAERRPAGPRDPASEIYLSLVDDGFNPSEP
ATGVLSVDTLCLNRDLPARLPFGGGHPVLKPAEAMSAIRAVSCLTPPTRTLRPEAGARGRWRLISFLSLN
HLSLTDDTDGAAALRELLALHDLRDAPETRAAIDAITGISHRRGMARVPGDRFGGMARGLDVTLELDPER
YATGGLYLLAAVLDRVLGLYCTINSFTRLTAKLRGRPGVIRTWPPRAGAQDLV
 
Nucleotide Sequence: 1842 bp     [Download]
>gi|442559580|ref|NC_017957.2|:c92216-90375 Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence
ATGACCGACGAACTGCTTCCCCATTACCAGCGCGAGCTGGTCGAGATCCGCCGCCGGGCGGGCGAGTTCG
CGGCGGCGCATCCCAAGATCGCCGGGCGGCTGCGCCTGACCGCCGATGCCGCCGATGACCCGTTCGTGGC
CCGGCTGATCGAGGCGGTGGCCTATCTGAATGCCCGCATCCAGCTGCGGCTGGACGATGCCTTCCCCGAG
CTGACCGATGCCCTTCTGGGGGTGCTGCACCCGCACTGGCTGGCGCCGGTGCCCTCGATGGCGATCGCGC
GGTTCACGCCGCAGGCGGATCTTTCGGGGCCCCATACCGTCCCGGCCGGGGCCGAGCTGGTGACGGGACC
CGTGGCCCCGGCCGAGGGGCGGGCGCCCGAACCCTGCCGCTTCCGCACCGCCTGGCCAGCTACCCTCTGG
CCGGTCGAGATCGAGACCGTGGCGTTGAAGGCGCGGCCGGTGGCGGCGCCGGCGATTGCCGGGGTGGAGC
AGGCGGTGGCGGTGCTGAAGATCGGGCTGCGGATGACGCAGCCCGGGCGCAGCTTCACCGAAATCGGGCT
GGACCGGCTGCGGCTGTTCATCGCCGCCCCCGGTGCCCAGGCGATGCGGCTTTACGAGCGACTGACCAAT
GATGTCGCCGGCATCGCGGTTGCCGCCGGCCCCGAGGATCCGCGGCCGGTGCGGCTCGGGCCGGATGCGG
TGGCGCCGGTGGGTTTTGCCGGGGATGAGGGGCTGCTGCCCGACGATGCCCGCACCCTGCCGGCCTATCG
GCTGCTGACCGAATATTTCGCCTTCCCCGAGAAATTCCTGTTCCTGGACCTGAACGGCCTTGATGCCCGC
ACGCTGGCGCCCACCGGCGACCGGCTGGAGATCCATGTCTTCCTCACCCGCCACGACCAGGATCTGGAGC
GGGCGGTGACGGCGGAGAGTTTTGCGCTGGGCGCCGTGCCGATCGTCAACCTGTTCCGCCAGGCCGCCGA
GCCGATCCGGCTGGATCAGCGCCAGTCTGCGTACCGGGTGGTGCCCGATGCCCGCCGGCCGCTCTCGACC
GAGATTTTCCGGATCCTGCGGGTCGAGGGCAGCGATTCAGGCGGCCGGCGGCAACTCTATCAACCCTTCC
ATTCCGTCGCCCACGGCACCGCCATGGCCGACGAGACCCGGCGCTGGTGGCATGCCGAGCGCCGGCCGGC
CGGGCCGCGCGATCCCGCGAGCGAGATCTATCTCAGCCTGGTCGATGACGGCTTCAATCCGTCCGAGCCC
GCTACCGGCGTGCTGTCGGTCGACACGCTGTGCCTGAACCGCGACCTGCCGGCGCGGCTGCCCTTCGGCG
GCGGCCATCCGGTGCTGAAACCGGCCGAGGCGATGTCGGCGATCCGGGCGGTGTCCTGCCTGACCCCGCC
CACCCGGACGCTGCGACCCGAGGCGGGGGCCCGCGGCCGCTGGCGGCTGATTTCCTTCCTGTCGCTCAAC
CATCTGTCGCTGACCGACGATACCGACGGGGCGGCCGCGCTGCGCGAACTGCTGGCGCTGCACGATCTGC
GCGACGCGCCCGAAACCCGGGCCGCGATCGATGCGATCACCGGCATTTCGCACCGCCGGGGCATGGCGCG
CGTGCCCGGCGACCGCTTCGGCGGCATGGCCCGCGGGTTGGATGTGACGCTCGAACTCGACCCCGAACGC
TATGCGACCGGCGGGCTCTATCTGCTCGCGGCGGTGCTCGACCGGGTGTTGGGACTTTATTGCACGATCA
ATTCCTTCACCCGGCTGACCGCGAAACTGCGGGGCCGGCCGGGCGTCATCCGCACCTGGCCGCCGCGCGC
GGGCGCGCAGGATCTGGTCTGA