SecReT6
Protein ID: 389875337
SecReT6 ID665
T6SS typei5
Gene symbol-
Locus tagTMO_a0085
StrainTistrella mobilis KA081020-065
Repliconplasmid pTM1 [GenBank: NC_017957] [Browse all T6SS(s) in this replicon]
Location [Strand]92213..92731 [-]
Producttype VI secretion system protein ImpF
NoteTssE
UniProt IDI3TRV0
KEGG IDtmo:TMO_a0085
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.40E-20, Aligned region: 42..148
Protein Sequence: 172 a.a.     [Download]
>gi|389875337|ref|YP_006373072.1| type VI secretion system protein ImpF [Tistrella mobilis KA081020-065]
MMPAGRSSAGGRREAGSVRMSILDRLLVDDERLAPDDRFTVEAFREGLRRDLEDLLNTRRRPVGWGAKLP
EVETALTNYGIADFTAQPVSSDDDRERLRAGIEAAIRQAEPRFRAVAVHLLDNSEAGDRTLRLRIDALVA
AEPAPEPMSFDGVVDPADRGVRVTATSDGGLI
 
Nucleotide Sequence: 519 bp     [Download]
>gi|442559580|ref|NC_017957.2|:c92731-92213 Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence
GTGATGCCGGCCGGGCGATCTTCCGCGGGCGGCCGGCGCGAGGCCGGATCGGTCCGGATGTCGATCCTGG
ACCGGCTGCTGGTCGATGACGAGCGCCTGGCGCCCGATGACCGTTTCACGGTGGAGGCCTTCCGCGAGGG
GCTGCGCCGCGACCTGGAAGACCTGCTCAACACCCGCCGCCGGCCGGTGGGCTGGGGGGCGAAGCTGCCC
GAGGTGGAAACCGCGCTCACCAATTACGGCATCGCCGATTTTACCGCCCAGCCGGTCTCGTCCGATGACG
ACCGCGAGCGGCTGCGCGCCGGCATCGAGGCGGCGATCCGCCAGGCGGAGCCGCGCTTCCGGGCGGTGGC
GGTACATCTGTTGGACAATTCCGAAGCCGGTGACCGCACGCTGCGGTTGCGGATCGACGCCCTGGTCGCC
GCCGAACCGGCGCCCGAGCCGATGAGCTTCGACGGCGTCGTGGACCCCGCCGATCGCGGCGTGCGGGTCA
CCGCCACCAGCGATGGCGGCCTGATATGA