SecReT6
Protein ID: 389875338
SecReT6 ID665
T6SS typei5
Gene symbol-
Locus tagTMO_a0086
StrainTistrella mobilis KA081020-065
Repliconplasmid pTM1 [GenBank: NC_017957] [Browse all T6SS(s) in this replicon]
Location [Strand]92728..93597 [-]
Producttype VI secretion system protein ImpE
NoteTagJ
UniProt IDI3TRV1
KEGG IDtmo:TMO_a0086
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 8.10E-31, Aligned region: 147..276
Protein Sequence: 289 a.a.     [Download]
>gi|389875338|ref|YP_006373073.1| type VI secretion system protein ImpE [Tistrella mobilis KA081020-065]
MKMMTSTADIHGAAALLQAGLLDEAIDAQLLRVRAHPADTTARHFLAELMVAAGELTRADRQLDMIADQA
PEQAVGLSGFRQLIRAEQIRREVMTEGRVPDFLDTPPPAVAKALEALVAIRAGRHADAAAAVIEAENLRP
RGAIEVNGTRVDDFRDACDLTGPVLELLTASGRYFWVPLERVRRMAFQAPRRLIDLIWRPVEVETEGGPD
GMVFMPSIYALTAESDDAALKLGRRTDWATGQGPGAPQAGPISGRGQRCFLAGDELMPALELTEIRRLCP
AAGSGEGAA
 
Nucleotide Sequence: 870 bp     [Download]
>gi|442559580|ref|NC_017957.2|:c93597-92728 Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence
ATGAAGATGATGACCTCCACCGCCGATATTCACGGTGCTGCGGCACTGCTCCAGGCGGGTCTGCTCGACG
AGGCGATCGATGCCCAGCTCCTGCGGGTGCGGGCGCACCCGGCCGATACCACGGCGCGCCATTTCCTGGC
CGAGCTGATGGTGGCGGCGGGGGAACTGACGCGCGCGGATCGTCAGCTCGACATGATCGCCGATCAGGCG
CCGGAACAGGCGGTGGGGCTTTCGGGCTTCCGTCAGCTGATCCGCGCCGAACAGATCCGACGCGAAGTGA
TGACCGAGGGCCGCGTGCCCGACTTCCTCGACACGCCGCCGCCCGCGGTCGCCAAGGCGCTTGAGGCGCT
GGTTGCGATCCGTGCCGGCCGCCATGCCGATGCGGCGGCGGCGGTGATCGAGGCCGAAAACCTGCGGCCG
CGCGGGGCCATCGAGGTGAACGGCACCCGGGTCGACGATTTCCGCGACGCCTGCGACCTCACCGGCCCGG
TGCTGGAACTGCTCACCGCCTCGGGCCGCTATTTCTGGGTCCCGCTCGAACGGGTGCGTCGGATGGCCTT
CCAGGCGCCGCGCCGGCTGATCGACCTGATCTGGCGGCCGGTCGAGGTGGAAACCGAAGGTGGGCCCGAC
GGCATGGTCTTCATGCCCTCGATCTATGCCCTGACCGCCGAGAGCGACGATGCCGCCCTCAAGCTGGGCC
GGCGCACCGACTGGGCCACCGGCCAGGGGCCCGGTGCGCCCCAGGCCGGGCCGATTTCCGGACGCGGCCA
GCGCTGCTTCCTGGCCGGCGACGAGCTGATGCCGGCCCTGGAGCTGACGGAGATCCGCCGGCTCTGCCCG
GCGGCCGGCAGCGGCGAAGGGGCGGCGTGA