SecReT6
Protein ID: 389875339
SecReT6 ID665
T6SS typei5
Gene symbol-
Locus tagTMO_a0087
StrainTistrella mobilis KA081020-065
Repliconplasmid pTM1 [GenBank: NC_017957] [Browse all T6SS(s) in this replicon]
Location [Strand]93663..95063 [-]
Producttype VI secretion system protein ImpC
NoteTssC
UniProt IDI3TRV2
KEGG IDtmo:TMO_a0087
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.70E-147, Aligned region: 27..456
Protein Sequence: 466 a.a.     [Download]
>gi|389875339|ref|YP_006373074.1| type VI secretion system protein ImpC [Tistrella mobilis KA081020-065]
MSVSLPLQSAPPLRAPPLRATALRPLIDRVIALIDAAIGRQLDRILHHPRMQALEAAWRGLALVVERAGR
ARSTKVRVLDVTWDMICRDFERAVEFDRAEMFAKIYEDEFGSPGGEPFGVLIGAYELMHLRDADHPTDDV
TGLKGMATVAAAAFAPFIAGAHPRLLGLDRFEALGRGFDPGDFEGADHVRWRGLRMGEDARFLGLTCPRI
LLRHPWGEDPARIDGFRYVEDVSGPDAGKYLWGVAAFAFALVLIRAHDATGWFADIRGAARDHELGGLVR
ELPADHFGTDRPDVGLKPPVDVQLTDAQDKRLADLGLIALAPARDTPWVVFHGNPSLQLARPYDREAASA
NARLSAMLQYMLCVSRFAHYVKVIGRDRVGSFSDAAACEEYLRRWLLGYSIASDTATPEQKARYPLRECA
VSVRESPGRPGIYDCTIHLRPHFQLDEVSSGFRLVTWFVARGLPQS
 
Nucleotide Sequence: 1401 bp     [Download]
>gi|442559580|ref|NC_017957.2|:c95063-93663 Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence
ATGTCCGTCTCGCTTCCCCTCCAGAGCGCCCCTCCGCTTCGTGCCCCTCCGCTTCGTGCCACGGCACTGC
GGCCGCTGATCGATCGGGTCATCGCCCTGATCGATGCGGCGATCGGCCGGCAGCTCGACCGGATCCTGCA
TCACCCGCGGATGCAGGCGCTGGAAGCGGCCTGGCGCGGCCTGGCGCTGGTGGTGGAACGGGCGGGCCGG
GCGCGGTCGACCAAGGTGCGGGTGCTGGACGTCACTTGGGACATGATCTGCCGCGATTTCGAGCGCGCGG
TCGAATTCGACCGTGCCGAGATGTTCGCCAAGATCTACGAAGACGAGTTCGGCAGCCCCGGCGGCGAGCC
CTTCGGCGTGCTGATCGGCGCCTATGAGCTGATGCATCTGCGCGATGCCGATCACCCCACCGACGACGTC
ACCGGCCTCAAGGGCATGGCGACGGTGGCGGCCGCGGCTTTCGCGCCCTTCATCGCCGGTGCCCATCCGC
GGCTGCTGGGCCTCGACCGGTTCGAGGCGCTGGGCCGCGGCTTCGATCCGGGCGATTTCGAGGGCGCGGA
TCATGTCCGCTGGCGGGGTCTCAGGATGGGCGAGGATGCCCGCTTCCTGGGGCTGACCTGCCCGCGGATC
CTGCTCCGCCACCCCTGGGGCGAGGATCCCGCCCGGATCGACGGTTTCCGCTATGTCGAGGACGTGTCGG
GCCCCGATGCCGGCAAGTATCTGTGGGGGGTGGCGGCCTTCGCCTTCGCCCTGGTGCTGATCCGCGCCCA
TGACGCCACCGGCTGGTTCGCCGACATCCGGGGGGCCGCCCGCGATCACGAGCTGGGCGGGCTGGTGCGC
GAGCTGCCGGCCGATCATTTCGGCACCGACCGTCCGGATGTCGGGCTGAAGCCGCCGGTCGACGTGCAGC
TGACCGATGCCCAGGACAAGCGGCTGGCGGATCTGGGGCTGATCGCGCTGGCGCCTGCCCGCGACACGCC
CTGGGTGGTGTTTCACGGCAACCCGTCGCTGCAGCTGGCACGGCCCTATGACCGCGAGGCGGCGAGCGCC
AATGCCCGGCTGTCGGCGATGTTGCAATACATGCTCTGTGTCAGCCGTTTCGCCCATTACGTTAAGGTTA
TCGGGCGGGATCGCGTAGGTAGTTTCTCCGATGCCGCGGCCTGCGAGGAATATCTCCGCCGCTGGCTGCT
CGGCTATTCGATCGCGAGCGACACCGCAACGCCGGAACAGAAAGCGCGCTATCCGCTTCGGGAATGTGCG
GTCTCGGTGCGCGAGTCCCCCGGTCGCCCGGGCATCTATGACTGCACCATCCATCTCAGGCCGCATTTCC
AGCTGGACGAGGTGAGTTCGGGCTTTCGCCTGGTCACCTGGTTCGTGGCGCGGGGGCTGCCCCAGTCATG
A