SecReT6
Protein ID: 389875340
SecReT6 ID665
T6SS typei5
Gene symbol-
Locus tagTMO_a0088
StrainTistrella mobilis KA081020-065
Repliconplasmid pTM1 [GenBank: NC_017957] [Browse all T6SS(s) in this replicon]
Location [Strand]95080..96576 [-]
Producttype VI secretion system protein ImpC
NoteTssC
UniProt IDI3TRV3
KEGG IDtmo:TMO_a0088
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.70E-191, Aligned region: 64..494
Protein Sequence: 498 a.a.     [Download]
>gi|389875340|ref|YP_006373075.1| type VI secretion system protein ImpC [Tistrella mobilis KA081020-065]
MSVIREESRAAEAGLAEAPVSLLDQAISATRQTDRDRAEELLRALTEEALKGTVRYSKNLTQTIDRAIKA
IDEKLSEQLGRIMHHEKFQKLEGSWRGMHHMVNFSETGRMLKIRMLNVSKRELHRDLTRAVEFDQSQLFR
KIYENEFGTPGGEPYGALIGDYEFTGEPEDMELLGQVSHVSAAAFAPFISAASPKMFGFDDFTELTRPRD
LEKIFESTEYTKWRSFRDSEDSRFVTLTMPRVLARLPYGRHTRRVDAFDFEEAPLDERGLRKAMDHGDYC
WMNAAYVMGTRLAEAFSMHGWCTAIRGAEGGGKVEGLPFDTFVSDDGDPDAKCPTEVGITDRREAELSRL
GFLPLCHYKNTDYAVFFGAQTTQRPKTYDRPEATANAAISARLPYIMATSRFAHYLKVMGRDKIGSFMEA
EDCEAWLNRWVMNYVNANKDSGPDMKARYPLAEARVSVKEVPGAPGTYNAVAWLRPWLQMEELTTSLRMV
ARIPGSGN
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|442559580|ref|NC_017957.2|:c96576-95080 Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence
ATGTCCGTGATCCGCGAAGAGAGCCGCGCCGCCGAAGCCGGTCTTGCCGAGGCCCCGGTCTCGTTGCTCG
ACCAGGCGATTTCCGCCACCCGCCAGACCGATCGCGACCGCGCGGAGGAACTGCTGCGCGCGCTGACCGA
AGAGGCGCTGAAGGGCACCGTCCGCTATTCCAAGAACCTGACCCAGACCATCGACCGCGCGATCAAGGCG
ATCGACGAGAAGCTGTCGGAACAGCTGGGCCGGATCATGCATCACGAGAAATTCCAGAAGCTGGAAGGCT
CGTGGCGCGGCATGCACCACATGGTCAACTTCTCCGAGACCGGGCGCATGCTGAAGATCCGCATGCTGAA
CGTGTCGAAGCGAGAGCTGCACCGCGACCTGACGCGGGCGGTGGAATTCGACCAGAGCCAGCTGTTCCGC
AAGATCTACGAGAACGAATTCGGCACCCCCGGCGGCGAGCCCTATGGCGCGCTGATCGGCGATTACGAAT
TCACCGGCGAGCCGGAAGACATGGAACTGCTGGGTCAGGTCTCCCACGTCTCGGCGGCGGCCTTCGCGCC
ATTCATCTCGGCGGCGTCGCCGAAGATGTTCGGCTTCGACGACTTCACCGAGCTGACCCGCCCGCGCGAC
CTGGAGAAGATCTTCGAATCGACCGAATACACCAAGTGGCGCAGCTTCCGCGACAGCGAGGACAGCCGCT
TCGTGACGCTGACCATGCCGCGGGTGCTGGCGCGCCTGCCCTACGGGCGGCACACGAGACGGGTCGATGC
CTTTGATTTCGAAGAGGCGCCGCTGGACGAGCGCGGCCTGCGCAAGGCCATGGATCACGGCGACTATTGC
TGGATGAACGCGGCCTATGTGATGGGCACGCGCCTGGCCGAGGCCTTCTCGATGCATGGCTGGTGCACGG
CGATCCGCGGCGCCGAGGGCGGCGGCAAGGTCGAGGGCCTGCCCTTCGACACCTTCGTTTCCGACGACGG
CGATCCGGATGCCAAATGCCCGACCGAGGTCGGCATCACCGACCGCCGCGAGGCCGAGCTGTCGCGGCTG
GGCTTCCTGCCGCTCTGCCATTACAAGAACACCGACTATGCGGTGTTCTTCGGCGCCCAGACCACCCAGC
GGCCCAAAACCTATGACCGGCCCGAAGCGACCGCCAATGCCGCGATCTCGGCCCGGCTGCCCTATATCAT
GGCCACCTCGCGCTTCGCCCATTACCTGAAGGTCATGGGCCGCGACAAGATCGGCTCGTTCATGGAGGCC
GAGGATTGCGAGGCCTGGCTGAACCGCTGGGTGATGAACTACGTCAACGCCAACAAGGACAGCGGCCCGG
ACATGAAGGCCCGCTATCCGCTGGCCGAGGCGCGGGTGTCGGTGAAGGAAGTCCCCGGTGCCCCCGGCAC
CTACAACGCCGTCGCCTGGCTCCGGCCCTGGCTGCAGATGGAAGAGCTGACGACCTCTCTGCGCATGGTC
GCCCGCATCCCCGGCAGCGGCAACTGA