SecReT6
Protein ID: 389875341
SecReT6 ID665
T6SS typei5
Gene symbol-
Locus tagTMO_a0089
StrainTistrella mobilis KA081020-065
Repliconplasmid pTM1 [GenBank: NC_017957] [Browse all T6SS(s) in this replicon]
Location [Strand]96582..97115 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDI3TRV4
KEGG IDtmo:TMO_a0089
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.80E-59, Aligned region: 10..166
Protein Sequence: 177 a.a.     [Download]
>gi|389875341|ref|YP_006373076.1| type VI secretion protein (plasmid) [Tistrella mobilis KA081020-065] [TssB]
MSATSIHEKLNRVRKPRVHITYQVETEGAVVDKELPFVIGVLGDFSGDPDPDRPLAPLRDRKFVQIDRDN
FDDVMARIAPHLDLRVENTLAGDGSEMAVHLNFTSLDDFEPGAVVRQVEPLRRLLETREKLRDLMGKVDR
SEELEELLERVLQDDARLAELSDALGVRAPADSKPGE
 
Nucleotide Sequence: 534 bp     [Download]
>gi|442559580|ref|NC_017957.2|:c97115-96582 Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence [TssB]
ATGTCCGCGACCAGTATCCATGAAAAGCTGAACCGGGTGCGCAAGCCCCGGGTTCACATCACCTACCAGG
TCGAGACCGAAGGCGCCGTCGTCGACAAGGAACTGCCCTTCGTCATCGGCGTGCTGGGCGATTTCTCGGG
CGATCCCGATCCCGACCGGCCGCTGGCGCCGCTGCGCGACCGCAAATTCGTGCAGATCGACCGCGACAAT
TTCGACGACGTCATGGCCCGGATCGCGCCGCATCTGGACCTGCGCGTCGAGAACACGCTGGCCGGCGACG
GCAGCGAGATGGCGGTGCATCTGAATTTCACCAGCCTGGACGATTTCGAGCCGGGCGCGGTGGTGCGCCA
GGTGGAGCCGCTGCGCCGGCTGCTGGAAACGCGCGAGAAGCTGCGTGACCTGATGGGCAAGGTCGACCGC
TCGGAAGAGCTGGAAGAGCTGCTTGAACGCGTGCTGCAGGACGATGCCCGGCTGGCCGAGCTGTCGGATG
CCCTGGGTGTGCGCGCCCCCGCCGACAGCAAGCCCGGGGAGTAA