SecReT6
Protein ID: 389875342
SecReT6 ID665
T6SS typei5
Gene symbol-
Locus tagTMO_a0090
StrainTistrella mobilis KA081020-065
Repliconplasmid pTM1 [GenBank: NC_017957] [Browse all T6SS(s) in this replicon]
Location [Strand]97175..98317 [-]
ProductimpA-related N-terminal protein
NoteTssA
UniProt IDI3TRV5
KEGG IDtmo:TMO_a0090
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.90E-20, Aligned region: 67..128
Protein Sequence: 380 a.a.     [Download]
>gi|389875342|ref|YP_006373077.1| impA-related N-terminal protein [Tistrella mobilis KA081020-065]
MPPSPKPDPAVQALLEPIAGARPAGEDPREDYRVDAPFRRLKDLRSAARAAERAAEVEDEPQAPAEHWPE
IDRLAADVLRHKAKDLEVAGLLIEAQVRLNGFAGLAFGFDVATGLIRNFWDGLWPAPDEDGIASRVRPLM
ALNGESGDGVLVQAIRKVPVLGPQGRGIALWQIDQAVELGRLEADRREQRLAKGAASMAMIEAAGREMTS
ADIDRAQAGIAAARAALARLDAALDQAAGRDAPPLARIRQVLEAAEQGLRLGLGARAPKTPEPAVEVVAA
PGDRPAAEALPAAAAAAPVPAGMALPVTAIATREDAFRVIEAVAGWFRTAEPHSPIAYTLEEAVRRGRLP
LTDLITELIRDETARRDFLIAAGIKPADAA
 
Nucleotide Sequence: 1143 bp     [Download]
>gi|442559580|ref|NC_017957.2|:c98317-97175 Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence
GTGCCGCCCAGTCCGAAACCCGACCCGGCCGTTCAGGCCCTGCTGGAGCCGATTGCAGGGGCCCGCCCCG
CGGGTGAGGACCCGCGCGAGGATTACCGGGTCGATGCCCCGTTCCGGCGTCTGAAGGATCTGCGCTCCGC
CGCCCGCGCCGCCGAACGTGCGGCAGAGGTGGAGGACGAGCCCCAGGCACCGGCCGAACACTGGCCCGAG
ATCGACCGGCTGGCGGCGGATGTGCTGCGCCACAAGGCCAAGGATCTGGAGGTGGCCGGGCTGCTGATCG
AGGCGCAGGTGCGCCTCAACGGCTTTGCCGGCCTGGCTTTCGGCTTCGACGTGGCGACCGGGCTGATCCG
CAATTTCTGGGACGGGCTGTGGCCCGCCCCGGACGAGGACGGCATTGCGTCGCGCGTGCGGCCGCTGATG
GCGCTGAACGGCGAAAGCGGTGATGGCGTGCTGGTCCAGGCGATCCGCAAGGTGCCGGTGCTGGGGCCGC
AGGGCCGTGGCATCGCCCTCTGGCAGATCGACCAGGCGGTGGAGCTGGGCCGGCTGGAGGCGGATCGTCG
CGAACAGCGCCTGGCCAAGGGTGCCGCCAGCATGGCGATGATCGAGGCCGCCGGCCGTGAGATGACCAGC
GCCGATATCGATCGTGCCCAGGCCGGCATCGCCGCCGCCCGCGCGGCGCTGGCCCGGCTGGATGCAGCCC
TCGATCAGGCCGCCGGCCGCGACGCGCCGCCGCTGGCCCGCATCCGTCAGGTGCTGGAGGCGGCCGAGCA
GGGGCTGCGCCTGGGACTTGGCGCCCGCGCGCCCAAGACGCCCGAGCCGGCTGTGGAGGTGGTTGCCGCC
CCCGGTGACCGGCCGGCCGCAGAGGCGCTTCCGGCTGCCGCTGCAGCCGCTCCCGTGCCGGCCGGCATGG
CCCTGCCGGTCACGGCGATCGCCACCCGCGAGGACGCCTTTCGGGTGATCGAGGCGGTGGCGGGGTGGTT
CCGCACCGCCGAGCCGCATTCGCCCATCGCCTACACGCTGGAGGAGGCCGTCCGCCGCGGCCGTCTGCCG
CTGACCGATCTGATCACCGAACTGATCCGCGACGAGACCGCCCGGCGCGATTTCCTGATCGCCGCCGGGA
TCAAGCCGGCCGACGCCGCCTGA