SecReT6
Protein ID: 389875344
SecReT6 ID665
T6SS typei5
Gene symbol-
Locus tagTMO_a0092
StrainTistrella mobilis KA081020-065
Repliconplasmid pTM1 [GenBank: NC_017957] [Browse all T6SS(s) in this replicon]
Location [Strand]99418..99891 [+]
Producthypothetical protein
NoteTssD
UniProt IDI3TRV7
KEGG IDtmo:TMO_a0092
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.40E-32, Aligned region: 3..133
Protein Sequence: 157 a.a.     [Download]
>gi|389875344|ref|YP_006373079.1| hypothetical protein TMO_a0092 [Tistrella mobilis KA081020-065]
MIYLNIEGIQGDATHETHKNWIDVSSMTWGTHRAVSTPSGSAQNREASEPVIGEVHITKLMDGSSLKLFE
AAATGNQGKQIQIHLVTTGNPGNTYMEYTLTDTLVSGYQINTSGDRPVEEITLNFTRVDMKYTTYDANNR
PLNNIAAGYDIATTRKS
 
Nucleotide Sequence: 474 bp     [Download]
>gi|442559580|ref|NC_017957.2|:99418-99891 Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence
ATGATCTATCTGAATATCGAGGGAATTCAGGGTGACGCCACCCACGAGACCCACAAGAACTGGATCGACG
TGTCGTCGATGACCTGGGGCACCCACCGGGCAGTCTCCACCCCCTCTGGTTCGGCCCAGAACCGCGAAGC
CTCGGAGCCGGTGATCGGCGAAGTGCACATCACCAAGCTGATGGACGGTTCGTCGCTGAAGCTGTTCGAG
GCCGCCGCCACCGGTAATCAGGGCAAGCAGATCCAGATCCACCTGGTCACCACGGGCAATCCCGGCAACA
CCTACATGGAATACACCCTCACCGACACGCTGGTGAGCGGCTACCAGATCAATACTTCGGGCGATCGCCC
GGTCGAGGAAATCACGCTGAACTTCACCCGCGTGGACATGAAGTACACCACCTATGATGCCAACAACCGG
CCGCTGAACAACATCGCCGCCGGCTACGACATCGCCACCACCCGGAAGTCCTGA