SecReT6
Protein ID: 389875347
SecReT6 ID665
T6SS typei5
Gene symbol-
Locus tagTMO_a0095
StrainTistrella mobilis KA081020-065
Repliconplasmid pTM1 [GenBank: NC_017957] [Browse all T6SS(s) in this replicon]
Location [Strand]101290..103272 [+]
ProductVgrG protein
NoteTssI
UniProt IDI3TRW0
KEGG IDtmo:TMO_a0095
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.10E-71, Aligned region: 48..348
Phage_base_V [PF04717], Evalue: 2.10E-23, Aligned region: 231..250
Phage_base_V [PF04717], Evalue: 2.10E-23, Aligned region: 389..481
Phage_base_V [PF04717], Evalue: 2.10E-23, Aligned region: 568..589
Protein Sequence: 660 a.a.     [Download]
>gi|389875347|ref|YP_006373082.1| VgrG protein [Tistrella mobilis KA081020-065]
MTDLTSPPSLGSGDLAALFGDVIQDGRLLTIDSPLGPDMLLLERLVGEEALSEPFRFELTVRAKRDDIAS
AELVGHKVSFTLERADGSRRPWSGHVERVVAGAAIAKGQRYYHLEVRPWLWQLTHKTDCRIFQDKSTLDI
LEEIFGEFGFRDYDFSGVLNTPPKRDYCVQYRESSFAFVSRLLEEDGIFYYFAHTDDGAHVLTLADGAHA
YVPVPEQELRYAATDVDLNNVTRWRHAWRFVPGRWAGSDYNFEMPGTDLASEAASVTPLETNRAFEIYDW
HARFQTRDAGARVSRRRMQAMETGHDTVQAASTARDLAPALSFTIFGHPAADEAGRGYAVVRIRHHAIDT
TYDTGPDRRPPTYENSFTALPVEVGFVPARTTPQPRIDGIQTATVVGPEGEEIHTDRYGRIKVQFPWDRY
ATGDDRSSCWLRVMQPWGGRNMGAQTIPRIGMEVMVSFVEGDPDRPLAIGIVPNAGTMPPLTLPATKTRT
AFKSASSPGGGGFNEMTFEDLAGAEELMMRAQRDQTELVGRNRMVNTANVSTQDTGTLWGSRVGDSEIVM
TQASILIQHKQSRIILDGERVRIEFTNGHFIDLSAEGVIISSTAKIVTVRDESNFTAVDGEGVVAKGKVV
HAVDASEGNDVTVSAEGVAVNGKVVLLNCE
 
Nucleotide Sequence: 1983 bp     [Download]
>gi|442559580|ref|NC_017957.2|:101290-103272 Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence
ATGACCGACCTCACCAGCCCGCCGTCTTTGGGGTCGGGCGATCTGGCGGCACTCTTCGGCGATGTGATCC
AGGATGGCCGCCTGCTCACCATCGACAGCCCGCTCGGGCCCGACATGCTGCTGCTCGAACGCCTGGTCGG
CGAGGAGGCGCTGTCGGAGCCCTTCCGCTTCGAGCTGACGGTGCGCGCGAAGCGTGACGACATCGCCTCG
GCCGAGCTGGTCGGGCACAAGGTGTCGTTCACCCTGGAACGCGCCGACGGCAGCCGCCGGCCGTGGAGCG
GCCATGTCGAGCGGGTGGTGGCGGGGGCGGCCATCGCCAAAGGCCAGCGCTACTACCATCTGGAAGTGCG
CCCCTGGCTCTGGCAATTGACCCATAAGACCGATTGCCGGATCTTCCAGGACAAGTCGACGCTCGACATC
CTGGAAGAGATCTTCGGGGAATTCGGCTTCCGGGATTACGATTTCTCGGGCGTGCTCAACACGCCGCCCA
AACGCGACTACTGCGTCCAGTACCGCGAGAGCAGCTTCGCCTTCGTCTCGCGGCTGCTGGAAGAGGACGG
CATCTTCTACTATTTCGCCCATACCGATGACGGCGCCCATGTGCTGACGCTTGCCGACGGGGCCCATGCC
TATGTGCCGGTGCCCGAGCAGGAGCTGCGCTACGCCGCGACCGATGTCGACCTCAACAACGTCACCCGCT
GGCGCCATGCCTGGCGCTTCGTGCCGGGGCGCTGGGCCGGGTCGGACTATAATTTCGAGATGCCCGGCAC
CGATCTCGCCAGCGAGGCCGCCTCGGTCACGCCGCTCGAGACCAACCGCGCCTTCGAGATCTATGACTGG
CATGCCCGTTTCCAGACCCGCGATGCCGGCGCCCGGGTCAGCCGGCGGCGGATGCAGGCGATGGAAACCG
GCCATGACACGGTGCAGGCGGCCTCCACCGCCCGCGATCTGGCGCCGGCGCTGTCGTTCACCATTTTCGG
CCATCCGGCGGCCGACGAGGCCGGGCGCGGCTATGCGGTGGTGCGCATCCGCCATCATGCGATCGACACC
ACCTATGATACGGGCCCCGACCGGCGGCCGCCGACCTACGAGAACAGCTTCACCGCCCTGCCGGTGGAGG
TGGGCTTCGTGCCCGCCCGCACCACCCCGCAGCCGCGGATCGACGGCATCCAGACCGCAACCGTGGTCGG
GCCTGAAGGCGAGGAAATCCACACCGACCGCTATGGCCGGATCAAGGTGCAGTTCCCCTGGGACCGCTAT
GCCACCGGCGACGACCGGTCGTCCTGCTGGCTGCGGGTGATGCAGCCCTGGGGCGGGCGCAATATGGGCG
CGCAGACCATTCCGCGCATCGGCATGGAGGTGATGGTCTCCTTCGTCGAGGGCGATCCCGACCGGCCGCT
CGCGATCGGCATCGTGCCCAATGCCGGCACCATGCCGCCCCTGACCCTGCCCGCGACCAAGACCCGCACC
GCCTTCAAATCGGCGTCGAGCCCGGGCGGCGGCGGCTTCAACGAGATGACCTTCGAAGATCTGGCCGGGG
CGGAAGAGCTGATGATGCGCGCCCAGCGCGACCAGACCGAACTGGTCGGCCGCAACCGCATGGTCAACAC
CGCCAATGTCTCCACCCAGGATACCGGCACGCTCTGGGGCAGCCGGGTGGGCGACAGCGAGATCGTGATG
ACCCAGGCCTCGATCCTGATCCAGCACAAGCAGAGCCGGATCATCCTGGATGGAGAGCGGGTGCGGATCG
AGTTCACCAACGGCCATTTCATCGACCTCTCGGCCGAGGGCGTGATCATCTCGTCCACCGCCAAGATCGT
GACCGTGCGCGACGAGAGCAATTTCACCGCCGTCGACGGCGAAGGCGTGGTCGCCAAGGGCAAGGTGGTC
CATGCGGTCGATGCCAGCGAGGGCAACGACGTGACCGTCTCGGCCGAAGGCGTCGCCGTCAACGGCAAGG
TCGTGCTGCTCAACTGCGAGTGA