SecReT6
Protein ID: 390950596
SecReT6 ID670
T6SS typei3
Gene symbol-
Locus tagThivi_2283
StrainThiocystis violascens DSM 198
Repliconchromosome [GenBank: NC_018012] [Browse all T6SS(s) in this replicon]
Location [Strand]2491497..2494250 [-]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDI3YB62
KEGG IDtvi:Thivi_2283
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 8.90E-39, Aligned region: 236..256
AAA_2 [PF07724], Evalue: 8.90E-39, Aligned region: 649..815
AAA [PF00004], Evalue: 7.30E-18, Aligned region: 236..369
AAA [PF00004], Evalue: 7.30E-18, Aligned region: 655..739
ClpB_D2-small [PF10431], Evalue: 1.50E-14, Aligned region: 218..230
ClpB_D2-small [PF10431], Evalue: 1.50E-14, Aligned region: 822..895
AAA_16 [PF13191], Evalue: 7.40E-14, Aligned region: 213..252
AAA_16 [PF13191], Evalue: 7.40E-14, Aligned region: 280..315
AAA_16 [PF13191], Evalue: 7.40E-14, Aligned region: 645..699
AAA_5 [PF07728], Evalue: 1.80E-11, Aligned region: 236..255
AAA_5 [PF07728], Evalue: 1.80E-11, Aligned region: 357..366
AAA_5 [PF07728], Evalue: 1.80E-11, Aligned region: 654..766
AAA_22 [PF13401], Evalue: 1.20E-07, Aligned region: 63..97
AAA_22 [PF13401], Evalue: 1.20E-07, Aligned region: 236..321
AAA_22 [PF13401], Evalue: 1.20E-07, Aligned region: 368..402
AAA_22 [PF13401], Evalue: 1.20E-07, Aligned region: 652..677
AAA_22 [PF13401], Evalue: 1.20E-07, Aligned region: 716..737
Sigma54_activat [PF00158], Evalue: 7.50E-07, Aligned region: 218..250
Sigma54_activat [PF00158], Evalue: 7.50E-07, Aligned region: 653..772
Arch_ATPase [PF01637], Evalue: 1.40E-05, Aligned region: 214..251
Arch_ATPase [PF01637], Evalue: 1.40E-05, Aligned region: 287..319
Arch_ATPase [PF01637], Evalue: 1.40E-05, Aligned region: 653..698
AAA_29 [PF13555], Evalue: 2.40E-05, Aligned region: 228..252
AAA_29 [PF13555], Evalue: 2.40E-05, Aligned region: 652..680
AAA_25 [PF13481], Evalue: 5.20E-05, Aligned region: 231..313
AAA_25 [PF13481], Evalue: 5.20E-05, Aligned region: 636..673
Zeta_toxin [PF06414], Evalue: 0.00019, Aligned region: 236..252
Zeta_toxin [PF06414], Evalue: 0.00019, Aligned region: 653..694
NACHT [PF05729], Evalue: 0.0008, Aligned region: 236..336
NACHT [PF05729], Evalue: 0.0008, Aligned region: 655..679
T2SE [PF00437], Evalue: 0.001, Aligned region: 183..250
T2SE [PF00437], Evalue: 0.001, Aligned region: 649..731
AAA_17 [PF13207], Evalue: 0.0015, Aligned region: 237..249
AAA_17 [PF13207], Evalue: 0.0015, Aligned region: 654..692
IstB_IS21 [PF01695], Evalue: 0.002, Aligned region: 220..257
IstB_IS21 [PF01695], Evalue: 0.002, Aligned region: 654..673
AAA_18 [PF13238], Evalue: 0.0035, Aligned region: 236..250
AAA_18 [PF13238], Evalue: 0.0035, Aligned region: 655..682
Hpr_kinase_C [PF07475], Evalue: 0.0047, Aligned region: 236..247
Hpr_kinase_C [PF07475], Evalue: 0.0047, Aligned region: 652..672
AAA_19 [PF13245], Evalue: 0.006, Aligned region: 235..253
AAA_19 [PF13245], Evalue: 0.006, Aligned region: 652..676
Torsin [PF06309], Evalue: 0.0088, Aligned region: 611..677
Protein Sequence: 917 a.a.     [Download]
>gi|390950596|ref|YP_006414355.1| type VI secretion ATPase, ClpV1 family [Thiocystis violascens DSM 198]
MPDISRVALFGKLNRLGYKAIESATVFCKLRGNPYVELVHWIHQILQLPDSDLHRIVKQFNLEPARLARD
ITESLDRLPGGSTSISDLSAHVEEAVERGWVYGSLMFKESQIRTGHLIVGILKTQGLRNALPAISKEFDK
VKIETLIERFGEIVGGSPEDAMGAQDGSQMGGGAAPGEASGAIAPAAMGKQEALQRFTVDLTEQARTGKL
DPIVGRDAEIRQIVDILMRRRQNNPLLTGEAGVGKTAVVEGFALKIVAGDVPPPLKDVTLRALDVGLLQA
GASMKGEFEQRLRSVIEEVQASQKPIILFIDEAHTLVGAGGAAGTGDAANLLKPALARGTLRTVAATTWA
EYKKHIEKDPALTRRFQVVQIGEPSEDKAILMMRGVASTMEKHHRVQVLDEALEASVKLSHRYIPARQLP
DKSVSLLDTACARVAISQHAVPPEVDDCRKRIAALENELAIIRRETAVGIETAERESAAAEKLTGEQARL
AEVEGRWEQEKALVEKILALRAQLRGIGSTVEASPDAPPGSAGVPPATDAEPTPATVANTPSDPERATRL
AELKDLQSQLHAMQGDRPLILPTVDHQAVAAVVEGWTGIPVGRMVKNELESILKLADTLEQRIIGQRHAL
DMIARRIQTSRARLDNPNKPIGVFLLAGTSGVGKTETALALAEVLYGGEQNVITINMSEYQEAHTVSTLK
GAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEVEKAHPDVHEIFFQVFDKGWMEDGEGRVIDFKNTLILLT
TNAGTELITRLCADPDLMPDPEGIAKALREPLLKVFPPALLGRLVTIPYYPLSDEMIGAIARLQLGRIAK
RVQENHKVPFTYDEEVIKLIASRCTELESGGRMIDTILTNTVLPRISEEFLIRMMEGMPIKRVHVSVWEG
EFRYGFE
 
Nucleotide Sequence: 2754 bp     [Download]
>gi|390948458|ref|NC_018012.1|:c2494250-2491497 Thiocystis violascens DSM 198 chromosome, complete genome
ATGCCCGACATCAGCCGCGTCGCCCTCTTCGGCAAGCTTAACCGGCTCGGTTACAAAGCCATCGAAAGCG
CCACCGTCTTCTGCAAGCTGCGCGGCAATCCCTATGTGGAACTGGTGCACTGGATTCACCAGATTCTGCA
ACTGCCGGACTCCGATCTGCACCGCATCGTCAAGCAATTCAACCTCGAACCCGCGCGGCTTGCCCGCGAC
ATCACCGAATCGCTCGACCGTCTCCCCGGCGGTTCCACCTCGATCTCCGATCTCTCGGCCCATGTCGAGG
AGGCCGTCGAACGCGGCTGGGTCTATGGCTCGCTGATGTTCAAGGAATCCCAGATCCGCACCGGTCATCT
GATCGTCGGCATCCTCAAGACCCAGGGGTTGCGCAACGCCCTGCCCGCCATCTCCAAGGAATTCGACAAG
GTCAAGATCGAGACGCTCATCGAGCGCTTCGGCGAGATCGTCGGCGGTTCGCCCGAGGACGCCATGGGCG
CGCAGGACGGCAGCCAGATGGGCGGCGGCGCAGCGCCCGGCGAGGCCAGCGGTGCCATCGCTCCCGCCGC
GATGGGCAAGCAGGAGGCGCTCCAGCGCTTCACCGTGGATCTGACCGAACAGGCGCGCACCGGCAAGCTC
GATCCCATCGTCGGGCGTGACGCCGAGATCCGCCAGATCGTCGACATCCTCATGCGCCGGCGTCAGAACA
ACCCGCTCCTGACCGGCGAGGCCGGCGTGGGCAAGACCGCCGTGGTCGAAGGCTTCGCGCTCAAGATCGT
GGCTGGCGATGTCCCGCCGCCGCTCAAGGATGTCACCCTGCGCGCGCTCGACGTTGGACTGTTGCAAGCC
GGCGCCAGCATGAAGGGCGAGTTCGAGCAACGTCTGCGCTCGGTCATCGAAGAAGTGCAGGCGTCGCAGA
AACCCATCATCCTCTTCATCGACGAGGCCCACACCCTGGTCGGCGCGGGCGGCGCGGCCGGCACCGGCGA
CGCGGCCAATTTGCTCAAGCCGGCGCTCGCGCGCGGGACGCTGCGCACGGTCGCCGCCACCACCTGGGCC
GAATATAAGAAACACATCGAAAAAGATCCGGCGCTGACCCGTCGCTTCCAGGTCGTGCAGATCGGCGAGC
CGAGCGAGGACAAGGCCATCCTCATGATGCGCGGCGTCGCCTCGACCATGGAGAAGCACCATCGGGTGCA
GGTGCTGGACGAGGCGCTGGAGGCATCAGTCAAACTGTCGCACCGCTACATCCCCGCGCGCCAACTCCCC
GACAAATCGGTCAGCCTGCTCGACACCGCCTGCGCCCGCGTCGCCATCAGTCAGCACGCCGTCCCGCCCG
AGGTCGACGACTGCCGCAAGCGCATCGCCGCGCTGGAGAACGAACTGGCCATCATCCGGCGCGAGACCGC
GGTCGGCATCGAGACCGCCGAGCGCGAGTCGGCGGCGGCGGAAAAACTGACCGGAGAGCAGGCGCGTCTG
GCCGAGGTCGAGGGACGCTGGGAGCAGGAAAAGGCGCTGGTGGAGAAGATCCTCGCCCTGCGCGCTCAAC
TGCGCGGAATCGGTAGCACGGTCGAGGCGTCTCCCGATGCCCCCCCTGGGAGCGCGGGCGTCCCGCCCGC
CACGGACGCCGAACCAACGCCAGCGACCGTGGCGAACACCCCCAGCGATCCCGAACGCGCGACGCGACTC
GCCGAACTGAAAGACCTGCAAAGCCAACTCCACGCCATGCAGGGCGACCGCCCGCTCATCCTGCCCACCG
TCGATCATCAGGCAGTCGCCGCCGTTGTCGAGGGTTGGACTGGCATCCCGGTCGGGCGCATGGTCAAGAA
CGAACTGGAATCCATTCTAAAACTTGCCGATACCCTGGAGCAGCGCATCATCGGCCAGCGCCACGCGCTC
GACATGATCGCGCGGCGCATCCAGACCTCGCGCGCCAGGCTAGACAATCCCAACAAACCCATCGGCGTCT
TCCTGCTCGCCGGCACCTCCGGCGTCGGCAAGACCGAAACCGCGCTCGCGCTCGCCGAGGTGCTCTATGG
CGGCGAGCAGAACGTCATCACCATCAACATGAGCGAGTATCAGGAGGCGCATACCGTCTCCACCCTCAAG
GGCGCACCGCCCGGCTATGTCGGCTATGGCGAGGGCGGCGTGCTCACCGAGGCGGTGCGCCGTCGGCCCT
ATTCGGTGGTGCTTTTGGACGAGGTGGAAAAAGCGCATCCCGATGTACACGAGATTTTCTTCCAGGTCTT
CGACAAAGGTTGGATGGAGGATGGCGAGGGGCGGGTGATCGATTTCAAGAATACGCTCATCCTGCTGACC
ACCAATGCCGGGACCGAATTGATCACCCGGCTGTGCGCCGATCCGGACCTGATGCCGGATCCGGAAGGGA
TCGCGAAGGCGTTGCGCGAGCCGTTATTGAAAGTGTTTCCGCCGGCGCTGTTGGGGCGGCTGGTGACCAT
TCCTTATTATCCGCTCAGTGACGAGATGATCGGAGCGATCGCGCGGTTGCAGTTGGGACGCATCGCCAAA
AGGGTGCAAGAAAATCACAAGGTACCCTTCACTTATGACGAAGAGGTGATTAAGCTTATTGCATCGCGAT
GCACGGAATTGGAGAGTGGCGGGCGGATGATCGATACCATTTTAACCAATACCGTTCTGCCTAGGATCAG
TGAAGAATTCCTGATCAGGATGATGGAAGGGATGCCGATAAAGCGGGTGCATGTGAGTGTGTGGGAGGGG
GAGTTTAGGTATGGGTTTGAGTGA