SecReT6
Protein ID: 390950597
SecReT6 ID670
T6SS typei3
Gene symbol-
Locus tagThivi_2284
StrainThiocystis violascens DSM 198
Repliconchromosome [GenBank: NC_018012] [Browse all T6SS(s) in this replicon]
Location [Strand]2494469..2495503 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDI3YB63
KEGG IDtvi:Thivi_2284
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.00E-116, Aligned region: 20..323
Protein Sequence: 344 a.a.     [Download]
>gi|390950597|ref|YP_006414356.1| type VI secretion protein [Thiocystis violascens DSM 198]
MAGENRTTSHQLALLRALEAAPYGFGFFQAMRQLECAYRERPRLGQTARPTQEPIRLAQQSSLSFAPSTL
AAFQPGTDSDPPRLSVYFLGLFGPNGPLPLHLSEYARDRQRNAGDPTFARFADIFHHRVLALFYRAWANA
RPTVSFDRPETDRFGVYLAAFFGQGMPAFRARDAMPDLAKLHYAGHLTAQTRHPDGLAAILTDFFRLPAR
IEEFVGHWLYLPPESQWRLGASRETGCLGLTAIVGPRIWDRQYKFRIRLGPLALDEYRRLLPGGDSLPRL
VAVVRNYLGDELDWDLNLVLRREETPPIQLGGQGQLGWTTWLTSRTPDQDPANLKLQPLRFTVP
 
Nucleotide Sequence: 1035 bp     [Download]
>gi|390948458|ref|NC_018012.1|:c2495503-2494469 Thiocystis violascens DSM 198 chromosome, complete genome
ATGGCCGGCGAGAATCGGACGACGTCACACCAGTTAGCTCTGCTGCGCGCGCTGGAAGCCGCCCCCTATG
GGTTCGGCTTCTTCCAGGCGATGCGCCAACTGGAATGCGCCTACCGCGAGCGTCCCCGGCTCGGTCAGAC
CGCGCGGCCGACACAAGAGCCGATCCGGCTCGCGCAACAGTCGTCGCTCAGCTTCGCCCCGTCCACGCTC
GCGGCCTTTCAGCCAGGCACGGACAGTGACCCGCCACGGCTGTCGGTCTATTTTCTCGGGCTCTTCGGCC
CCAATGGTCCGCTGCCGCTGCATCTGAGCGAATACGCCCGCGACCGTCAGCGCAACGCCGGCGACCCGAC
CTTCGCGCGCTTCGCCGACATCTTCCATCATCGCGTCTTGGCGCTGTTCTACCGCGCCTGGGCCAACGCC
CGTCCTACGGTGAGCTTCGACCGTCCCGAGACCGACCGCTTCGGCGTCTATCTGGCCGCGTTCTTCGGTC
AGGGCATGCCTGCGTTCCGTGCGCGCGACGCCATGCCGGATCTCGCCAAGCTCCACTACGCTGGCCACCT
GACCGCGCAGACCCGGCACCCCGACGGACTGGCCGCGATCCTGACCGACTTCTTCCGGCTGCCGGCGCGC
ATCGAGGAGTTTGTCGGGCATTGGCTCTACCTGCCGCCCGAATCCCAATGGCGCCTCGGCGCCTCGCGCG
AGACCGGCTGTCTGGGACTCACCGCCATCGTCGGTCCCCGCATCTGGGACCGCCAGTACAAATTTCGCAT
CCGTCTCGGTCCGCTCGCACTCGACGAGTATCGCCGCCTGTTGCCGGGCGGCGACAGCCTGCCGCGACTG
GTGGCCGTCGTGCGCAACTATCTGGGCGACGAACTCGACTGGGATCTCAACCTCGTCCTGCGCCGCGAGG
AAACGCCGCCGATCCAACTCGGGGGACAGGGACAGCTTGGCTGGACCACCTGGCTGACCAGCCGCACACC
GGATCAAGACCCGGCGAACCTGAAGCTTCAGCCACTGCGCTTTACCGTGCCGTAG