SecReT6
Protein ID: 390950598
SecReT6 ID670
T6SS typei3
Gene symbol-
Locus tagThivi_2285
StrainThiocystis violascens DSM 198
Repliconchromosome [GenBank: NC_018012] [Browse all T6SS(s) in this replicon]
Location [Strand]2495467..2497368 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDI3YB64
KEGG IDtvi:Thivi_2285
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.20E-215, Aligned region: 5..630
Protein Sequence: 633 a.a.     [Download]
>gi|390950598|ref|YP_006414357.1| type VI secretion protein [Thiocystis violascens DSM 198]
MDPDFLRYYNRELQFIREMGAEFARDYPKIAGRIGLDGFECADPYVERLLEGFAFLTARVQLKLDAEFPN
FTQHLLEMVYPHYLAPTPSMAVVQCQPDATKGSDLASGFTIPRGSSLRSLLGKGERTACEYRTAADVTLW
PIELIEARPLSLAAALAVNAESVKGVKAGIRFRLRIAPELTFDQLPLDRLRLFLRGGDGLRMRLYEQLLG
HALAVVVRPGTHPAPWQNRLNADCIRRVGFDDAEALLPYGPQSFQGYRLLQEYFAFPERYLFVEFSGLQP
SIRRCHETELDLVVLLDQGGVFAEDAFDASYFALHCTPAINLFPKRADRIHLSNQSHEHHVVPDRTMPLD
LEVFSVTDVVGIGTHSEPEQEFLPFYTSHDLVGGRAHRAYYTIQRMPRVPSEQQRQRGPRSSYLGGELFI
SLVDADEAPYRHNLRQLAVGTLCTNRDLPLLLPIGKGDTDFTLALSAPVQSVRCVAGPTKPRPSFPRGDS
AWRLISHLSLNYLSLCDRDSEQGANALRELLTLYSDVSDAAIRGQVDGVRSVRTVPVTRRLPPASAAPGA
RPERVAFARGLQITLTLDPAAFEGSGVFLLGAVLEQFFAKYVSINSFTETIVTTPDHGEVMRWPARIGRR
HTS
 
Nucleotide Sequence: 1902 bp     [Download]
>gi|390948458|ref|NC_018012.1|:c2497368-2495467 Thiocystis violascens DSM 198 chromosome, complete genome
ATGGATCCCGATTTTCTCCGCTATTACAACCGCGAACTCCAGTTCATCCGCGAGATGGGCGCCGAGTTCG
CCCGCGACTATCCCAAGATCGCCGGCCGGATCGGTCTGGATGGTTTCGAGTGCGCCGATCCCTATGTCGA
ACGCCTGCTGGAGGGCTTCGCCTTCCTGACGGCGCGGGTCCAACTGAAGCTGGACGCCGAGTTCCCCAAC
TTCACCCAGCACCTGCTGGAGATGGTTTATCCGCATTATCTGGCCCCGACGCCCTCGATGGCGGTGGTCC
AGTGTCAGCCCGACGCGACCAAGGGAAGCGATCTTGCAAGCGGTTTCACGATCCCGCGCGGCAGCAGCCT
GCGCAGTCTTCTCGGCAAGGGCGAGCGAACCGCCTGCGAGTATCGCACCGCCGCCGATGTCACCCTCTGG
CCCATCGAACTGATCGAGGCCAGGCCGCTGTCGCTCGCCGCAGCGCTGGCCGTGAACGCCGAGAGCGTGA
AGGGCGTCAAGGCGGGTATCCGTTTCCGGCTGCGAATCGCGCCCGAACTGACCTTCGACCAACTGCCGCT
CGACCGTCTTCGCCTTTTTCTGCGCGGCGGCGACGGGTTGCGGATGCGTCTGTACGAGCAACTGCTTGGC
CACGCACTCGCGGTCGTGGTCAGACCGGGCACGCATCCCGCTCCCTGGCAGAACCGGCTCAACGCGGACT
GCATCCGGCGCGTCGGTTTCGACGACGCCGAAGCCTTGCTGCCCTACGGTCCCCAGTCCTTTCAGGGCTA
CCGGTTATTGCAGGAATACTTCGCCTTTCCAGAGCGTTATCTGTTCGTCGAGTTCAGCGGACTCCAGCCG
TCGATACGCCGCTGCCACGAGACCGAACTGGATCTCGTCGTCCTGCTCGATCAGGGCGGGGTCTTCGCCG
AAGACGCCTTTGACGCCTCCTATTTCGCGCTCCATTGCACCCCCGCGATCAACCTCTTCCCCAAGCGGGC
CGACCGGATTCATCTGAGCAACCAGAGTCACGAGCATCATGTCGTTCCGGATCGGACCATGCCGTTGGAC
CTGGAGGTCTTCAGCGTCACGGACGTTGTCGGCATTGGCACCCACAGCGAACCCGAGCAGGAATTCCTGC
CCTTCTACACCTCGCATGACCTGGTCGGCGGACGCGCGCATCGGGCCTATTACACGATCCAACGCATGCC
GCGCGTGCCTTCCGAGCAGCAACGCCAGCGCGGACCGCGCTCCAGTTATCTTGGCGGCGAGCTTTTCATC
AGCCTGGTGGACGCGGACGAGGCGCCCTACCGGCACAACCTGCGGCAATTGGCGGTGGGCACGCTCTGCA
CCAATCGCGACCTGCCGCTGCTCTTGCCCATCGGCAAGGGCGACACCGATTTCACCCTGGCTCTCAGCGC
GCCGGTGCAGTCGGTACGCTGCGTCGCCGGACCGACCAAGCCGCGTCCGTCCTTTCCACGAGGCGACAGC
GCCTGGCGGCTCATCAGCCATCTCTCGCTGAATTATCTGTCGCTCTGCGACCGGGATAGCGAACAGGGCG
CCAACGCGCTACGCGAGCTTCTGACCCTCTACAGCGACGTCAGCGATGCCGCGATCCGTGGTCAGGTGGA
TGGCGTGCGCTCGGTGCGAACGGTGCCCGTCACCCGGCGTCTGCCGCCCGCCTCGGCGGCACCCGGCGCC
CGTCCCGAACGCGTCGCCTTCGCCCGCGGACTTCAAATTACCCTGACCCTCGATCCCGCGGCCTTCGAGG
GCAGTGGCGTCTTTCTGCTGGGGGCCGTCTTGGAGCAGTTTTTCGCGAAATATGTCTCGATCAATTCCTT
TACCGAAACGATCGTCACGACCCCCGATCACGGCGAGGTAATGCGATGGCCGGCGAGAATCGGACGACGT
CACACCAGTTAG