SecReT6
Protein ID: 390950599
SecReT6 ID670
T6SS typei3
Gene symbol-
Locus tagThivi_2286
StrainThiocystis violascens DSM 198
Repliconchromosome [GenBank: NC_018012] [Browse all T6SS(s) in this replicon]
Location [Strand]2497370..2497930 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDI3YB65
KEGG IDtvi:Thivi_2286
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.40E-24, Aligned region: 52..162
Protein Sequence: 186 a.a.     [Download]
>gi|390950599|ref|YP_006414358.1| type VI secretion system lysozyme-like protein [Thiocystis violascens DSM 198]
MCAASTWTRPTRPVPRVAELTQKERLQPALLDRLTDEAPDRRQESREQRVLSMRQLRASVLRDLTWLLNC
GRLDSVQDLTEYPFVAHSVLNYGIPDITGLTASGVDAVQIERAVRQAIWDFEPRILRQTVRVSARLDSER
MSHNTLTFDIEGDLWAQPVPLRIYLKTELDLELGEVRIVEQSGPGG
 
Nucleotide Sequence: 561 bp     [Download]
>gi|390948458|ref|NC_018012.1|:c2497930-2497370 Thiocystis violascens DSM 198 chromosome, complete genome
ATGTGCGCCGCATCGACCTGGACGCGCCCGACGCGGCCGGTTCCGCGCGTGGCTGAACTGACCCAAAAAG
AGCGCCTGCAACCGGCGCTCCTCGACCGCCTGACCGACGAAGCGCCGGATCGTCGGCAGGAGTCGCGCGA
GCAGCGCGTCCTTTCCATGCGTCAGTTGCGCGCGAGCGTCCTGCGCGATCTGACCTGGCTGCTGAACTGC
GGTCGTCTCGACAGCGTTCAGGATCTGACGGAATACCCCTTCGTGGCCCACTCGGTACTCAACTACGGAA
TCCCGGACATCACCGGACTCACCGCCTCCGGGGTGGACGCGGTCCAGATCGAGCGCGCGGTTCGCCAGGC
GATCTGGGACTTCGAGCCCCGTATTCTGCGCCAGACGGTGCGCGTCTCCGCCCGCTTGGATAGCGAGCGC
ATGAGCCACAACACGCTCACCTTCGATATCGAGGGCGACCTCTGGGCGCAGCCGGTGCCCTTGCGAATCT
ACCTCAAGACCGAACTGGATCTCGAACTCGGCGAGGTCAGGATCGTCGAGCAGTCCGGGCCTGGCGGCTG
A