SecReT6
Protein ID: 390950600
SecReT6 ID670
T6SS typei3
Gene symbol-
Locus tagThivi_2287
StrainThiocystis violascens DSM 198
Repliconchromosome [GenBank: NC_018012] [Browse all T6SS(s) in this replicon]
Location [Strand]2497875..2498690 [-]
Productprotein of avirulence locus involved in temperature-dependent protein secretion
NoteTagJ
UniProt IDI3YB66
KEGG IDtvi:Thivi_2287
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 1.10E-44, Aligned region: 137..259
TPR_16 [PF13432], Evalue: 0.00018, Aligned region: 1..53
TPR_16 [PF13432], Evalue: 0.00018, Aligned region: 104..130
TPR_19 [PF14559], Evalue: 0.00044, Aligned region: 7..63
TPR_19 [PF14559], Evalue: 0.00044, Aligned region: 99..131
RecO_C [PF02565], Evalue: 0.0091, Aligned region: 12..44
Protein Sequence: 271 a.a.     [Download]
>gi|390950600|ref|YP_006414359.1| protein of avirulence locus involved in temperature-dependent protein secretion [Thiocystis violascens DSM 198]
MLAEDRLREGDLEGTLRQLQEQVRKDPANASYRVFLFQLLALMGQWERALNQLGVAGELDASTLAMVQTY
REALRCEVLRGKIFEGRQTPLIFGRPDAWVALLLEAHRLIAQGAIEQANAVREQALEAAPTTSGAIDGTP
FDWIMDADARLGPVLEAIVNGRYYWIPFQCIRSIAVEKPEDLRDLVWMPAHFTWANGGETVGLIPTRYPG
AESHPDQLIRLARKTDWLEPAPGLYLGQGQRMLTTDAGDSSLMDVRRIDLDAPDAAGSARG
 
Nucleotide Sequence: 816 bp     [Download]
>gi|390948458|ref|NC_018012.1|:c2498690-2497875 Thiocystis violascens DSM 198 chromosome, complete genome
ATGCTAGCCGAAGACCGCTTGCGCGAAGGCGATCTGGAAGGGACTCTACGCCAGCTCCAGGAACAGGTGC
GCAAAGACCCCGCCAACGCGAGCTATCGCGTCTTTCTCTTTCAACTCCTGGCCCTCATGGGGCAATGGGA
GCGCGCGCTCAACCAACTCGGCGTGGCCGGAGAACTGGACGCCAGTACCCTGGCCATGGTCCAGACCTAC
CGCGAAGCCCTGCGCTGCGAGGTGCTGCGCGGCAAAATCTTCGAAGGTCGACAGACGCCGCTGATTTTCG
GTCGGCCCGACGCCTGGGTCGCCCTCCTGCTTGAGGCCCATCGCCTGATCGCGCAGGGTGCGATCGAGCA
GGCAAACGCGGTGCGCGAGCAGGCCCTGGAAGCGGCCCCGACCACCTCCGGTGCTATCGACGGCACGCCA
TTCGACTGGATCATGGACGCCGACGCGCGCCTGGGGCCGGTCCTGGAGGCGATCGTCAACGGTCGCTATT
ACTGGATTCCCTTCCAGTGCATCCGCTCCATCGCTGTGGAAAAACCCGAGGATCTGCGCGATCTGGTGTG
GATGCCGGCGCATTTCACCTGGGCCAACGGCGGCGAAACGGTGGGCCTGATTCCGACCCGCTATCCGGGC
GCCGAGTCGCACCCGGATCAACTGATCCGTCTGGCGCGCAAGACCGACTGGCTGGAGCCCGCGCCCGGTC
TTTATCTGGGGCAGGGACAGCGCATGCTGACCACGGACGCCGGCGATTCTTCGCTGATGGATGTGCGCCG
CATCGACCTGGACGCGCCCGACGCGGCCGGTTCCGCGCGTGGCTGA