SecReT6
Protein ID: 390950601
SecReT6 ID670
T6SS typei3
Gene symbol-
Locus tagThivi_2288
StrainThiocystis violascens DSM 198
Repliconchromosome [GenBank: NC_018012] [Browse all T6SS(s) in this replicon]
Location [Strand]2498797..2499285 [-]
Producthemolysin-coregulated protein
NoteTssD
UniProt IDI3YB67
KEGG IDtvi:Thivi_2288
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.40E-44, Aligned region: 6..137
Protein Sequence: 162 a.a.     [Download]
>gi|390950601|ref|YP_006414360.1| hemolysin-coregulated protein [Thiocystis violascens DSM 198]
MAVDMFLKLEGVKGEAQDDKHKGEIDVLAWSWGMSQSGTMHTGGGGGGGKVSIQDLSITKYIDKSSPVLM
MYCSNGKQFKDGLLTVRKAGGDNPLEYLKIKMTEVIVTSYSTGGSGGQDLLTENVSLNFAEVDVDYQPQK
QDGSPDGGAIKYGWDIAKNVKK
 
Nucleotide Sequence: 489 bp     [Download]
>gi|390948458|ref|NC_018012.1|:c2499285-2498797 Thiocystis violascens DSM 198 chromosome, complete genome
ATGGCTGTTGATATGTTTCTCAAGCTTGAAGGCGTCAAGGGCGAGGCCCAGGACGACAAGCACAAGGGGG
AGATCGACGTCCTCGCCTGGTCCTGGGGCATGAGCCAGTCCGGCACCATGCATACCGGCGGCGGCGGCGG
CGGCGGTAAGGTCTCGATTCAGGATCTGTCGATCACGAAATATATCGACAAGTCCTCTCCGGTCCTGATG
ATGTATTGCTCCAATGGCAAACAGTTCAAGGATGGTCTGCTGACCGTGCGCAAGGCTGGCGGCGATAACC
CGCTGGAGTATTTGAAGATCAAGATGACCGAGGTGATCGTGACCTCCTACAGCACCGGCGGCTCGGGCGG
CCAGGATCTGCTGACCGAGAATGTCTCGCTGAACTTTGCCGAGGTCGATGTCGACTACCAGCCGCAGAAA
CAGGATGGCAGTCCAGACGGCGGAGCCATCAAGTACGGCTGGGACATCGCGAAAAACGTCAAGAAATAA