SecReT6
Protein ID: 390950602
SecReT6 ID670
T6SS typei3
Gene symbol-
Locus tagThivi_2289
StrainThiocystis violascens DSM 198
Repliconchromosome [GenBank: NC_018012] [Browse all T6SS(s) in this replicon]
Location [Strand]2499396..2500895 [-]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDI3YB68
KEGG IDtvi:Thivi_2289
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.00E-196, Aligned region: 70..494
Protein Sequence: 499 a.a.     [Download]
>gi|390950602|ref|YP_006414361.1| type VI secretion protein EvpB [Thiocystis violascens DSM 198]
MAEADTLAQEPQAAEATLEAGDFSALLEKEFRPKSDRAKEAVTEAVKTLAEQALTGSVVVSADVVNTIGS
IIAEIDKKLSEQVNLILHHADFQQLEGAWRGLHYMVNNTETDEMLKIRVMNISKKDVHKTLKKYKGTAWD
QSPLFKRMYDEEYGQFGGEPFGCLVGDYHFDHSPPDVEFLGEIAKISASMHCPFIAGADPAVMQMDSWSE
LANPRDLTKIFQTPEYAAWRSLRESEDARYLGLTMPRFLARLPYGAKTNPVDEFDFEEDTEGAQHDKYTW
ANSAYAMATNINRSFKLYGWCSRIRGIESGGAVEGLPTHTFPTDDGGVDMKCPTEIAIADRREAELAKNG
FMPLIHKKNSDFAAFIGAQSLQKPAEYDDPDATANANLAARLPYLFATCRFAHYLKCIVRDKVGSFKERE
DMERWLNSWILQYVDGDPAHSSETTKAKCPLAAAEVTVEEVEGNPGYYRSKFFLRPHYQLEGLTVSLRLV
SKLPSAKGG
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|390948458|ref|NC_018012.1|:c2500895-2499396 Thiocystis violascens DSM 198 chromosome, complete genome
GTGGCTGAAGCAGACACCCTGGCCCAAGAACCCCAAGCAGCCGAAGCCACCCTCGAAGCCGGCGATTTCA
GCGCGTTGCTCGAAAAGGAATTTCGTCCCAAATCCGACCGCGCGAAAGAGGCGGTCACCGAGGCGGTCAA
GACCCTCGCCGAACAGGCGCTCACCGGTTCGGTCGTCGTCTCCGCCGACGTGGTCAATACCATCGGCTCC
ATCATCGCCGAGATCGACAAAAAACTCAGCGAACAGGTCAACCTGATCCTGCATCACGCCGATTTCCAGC
AGCTCGAAGGCGCCTGGCGCGGCCTGCACTACATGGTCAACAACACCGAAACCGACGAGATGCTCAAAAT
CCGGGTCATGAACATCTCCAAAAAGGACGTTCACAAGACCCTCAAGAAATACAAGGGCACCGCCTGGGAT
CAGAGCCCGCTTTTCAAACGGATGTACGACGAAGAATACGGACAGTTCGGCGGCGAGCCCTTCGGCTGTC
TGGTCGGCGACTATCACTTCGACCATAGCCCGCCCGATGTCGAGTTCCTGGGCGAGATTGCCAAGATCAG
CGCCTCCATGCACTGTCCCTTTATCGCCGGCGCGGACCCCGCCGTCATGCAGATGGATTCCTGGAGCGAA
CTGGCCAACCCGCGCGATCTGACCAAGATCTTCCAGACCCCGGAATACGCGGCCTGGCGCTCGCTACGCG
AATCCGAGGACGCCCGTTATCTGGGGCTGACCATGCCGCGCTTCCTCGCGCGTCTGCCCTATGGCGCCAA
GACCAATCCGGTCGACGAGTTCGACTTCGAGGAGGATACCGAGGGCGCCCAGCACGACAAATACACCTGG
GCCAATTCGGCCTACGCGATGGCGACCAACATCAACCGCTCCTTCAAGCTGTATGGCTGGTGCTCGCGCA
TCCGCGGCATCGAGTCCGGCGGCGCGGTGGAGGGACTGCCGACCCATACCTTCCCGACCGACGACGGCGG
CGTCGACATGAAATGCCCGACCGAGATCGCCATCGCCGACCGGCGCGAGGCCGAGCTGGCCAAGAACGGC
TTCATGCCGCTGATCCACAAGAAGAACTCCGACTTCGCGGCCTTCATCGGCGCGCAATCGCTGCAGAAAC
CGGCCGAGTACGACGACCCGGACGCCACCGCTAACGCCAACCTGGCGGCACGCCTGCCGTATCTGTTCGC
GACCTGTCGCTTCGCGCACTACCTCAAGTGCATCGTGCGCGACAAGGTCGGCTCCTTCAAGGAGCGCGAG
GATATGGAACGTTGGCTCAACTCTTGGATCCTTCAGTATGTCGATGGAGATCCGGCGCATTCGAGCGAAA
CCACCAAGGCCAAATGTCCGCTGGCGGCGGCCGAGGTGACGGTCGAGGAGGTGGAGGGCAATCCGGGCTA
CTACAGATCCAAGTTTTTCCTGCGTCCGCATTACCAGCTCGAAGGGCTGACCGTTTCGTTGCGGTTGGTC
TCCAAGTTGCCGTCGGCGAAGGGCGGTTAG