SecReT6
Protein ID: 390950603
SecReT6 ID670
T6SS typei3
Gene symbol-
Locus tagThivi_2290
StrainThiocystis violascens DSM 198
Repliconchromosome [GenBank: NC_018012] [Browse all T6SS(s) in this replicon]
Location [Strand]2500899..2501429 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDI3YB69
KEGG IDtvi:Thivi_2290
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.70E-60, Aligned region: 9..162
Protein Sequence: 176 a.a.     [Download]
>gi|390950603|ref|YP_006414362.1| type VI secretion protein [Thiocystis violascens DSM 198]
MAQSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVLADLSGKPAEPLPAVGDRKFLEIDVDNFDD
RLKAMKPRAAFQVPNTLTGEGNLSVDITFESMDDFSPAAVARKVGALSKLLEAREQLSNLLSYMDGKTGA
EELIAKALADPALLQALASAPKPSGEAADASTTTEG
 
Nucleotide Sequence: 531 bp     [Download]
>gi|390948458|ref|NC_018012.1|:c2501429-2500899 Thiocystis violascens DSM 198 chromosome, complete genome
GTGGCCCAAAGCAGCCAGAAATTCATCGCCAGAAATCGTGCCCCAAGGGTTCAGATCGAATATGACGTGG
AACTCTACGGGGCCGAAAAAAAGGTCCAGCTTCCCTTCGTGATGGGTGTTCTGGCCGACCTGTCCGGCAA
ACCGGCGGAACCGCTCCCAGCGGTTGGCGACCGCAAATTCCTGGAGATCGATGTCGATAACTTCGATGAT
CGACTCAAGGCGATGAAACCGCGCGCGGCGTTTCAGGTGCCCAATACCCTGACGGGCGAGGGTAACCTCA
GCGTCGATATCACCTTCGAGAGCATGGACGATTTTTCTCCCGCCGCGGTTGCACGCAAGGTCGGCGCGCT
GAGCAAACTGCTGGAGGCGCGTGAGCAACTCTCCAATCTGTTGAGCTACATGGATGGCAAGACGGGCGCC
GAGGAGTTGATCGCCAAGGCGCTCGCCGATCCCGCGCTGCTCCAGGCATTGGCCTCGGCCCCCAAGCCGT
CGGGCGAGGCGGCCGACGCATCGACGACGACGGAGGGCTAA