SecReT6
Protein ID: 390950604
SecReT6 ID670
T6SS typei3
Gene symbol-
Locus tagThivi_2291
StrainThiocystis violascens DSM 198
Repliconchromosome [GenBank: NC_018012] [Browse all T6SS(s) in this replicon]
Location [Strand]2501460..2502521 [-]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDI3YB70
KEGG IDtvi:Thivi_2291
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.00E-25, Aligned region: 53..113
Protein Sequence: 353 a.a.     [Download]
>gi|390950604|ref|YP_006414363.1| type VI secretion-associated protein, ImpA family [Thiocystis violascens DSM 198]
MIDIDSLLKEISPETPCGDDLEYDAAYGALERATQGKPEQQFGNTVVPAEGPDWAQVQREASDLLGRTKD
LRVAAYLTQALIRLQGWEGFRDGLILIKGLLERYWEGVHPQLDPDDDLDPTLRVNTIATLADPNTSLEGL
RAAPLVSARGIGAFGLRDLQLATKTVAAPAGNETPAPELQVIEAAFQGVELDALRATADAIGQSRNLVAG
IETLLLEQVGVGAAPDLAALNAVIAEAQKAVAAPLAQRTGQPVASEDLPTEPSSAETPGLTPGERSVVST
TPGAIKTRGDVVRTLELLCEYYRRQEPSSPIPLLLNRAKRLVSKDFLEILRDLAPDGLAQAEVIRGPDAD
ESA
 
Nucleotide Sequence: 1062 bp     [Download]
>gi|390948458|ref|NC_018012.1|:c2502521-2501460 Thiocystis violascens DSM 198 chromosome, complete genome
TTGATCGATATCGATAGCTTACTCAAGGAAATCTCTCCCGAGACGCCGTGCGGCGACGATCTGGAGTATG
ACGCCGCCTATGGCGCGCTCGAACGCGCCACCCAAGGCAAACCGGAACAGCAGTTCGGAAACACCGTCGT
CCCGGCCGAAGGCCCCGACTGGGCGCAGGTACAACGCGAGGCGAGCGATCTCCTTGGACGAACCAAGGAT
CTGCGTGTCGCGGCCTATCTGACGCAAGCCCTCATCCGCCTGCAGGGCTGGGAGGGATTCCGCGACGGCT
TGATCTTGATCAAAGGTCTGCTGGAGCGGTATTGGGAGGGCGTTCATCCGCAACTCGATCCGGATGACGA
CCTTGACCCCACGCTGCGCGTCAATACCATCGCGACACTCGCCGATCCGAATACCTCGCTGGAGGGCTTG
CGCGCGGCGCCGCTGGTCAGCGCGCGCGGGATCGGAGCCTTCGGTCTGCGCGACCTGCAACTCGCGACCA
AGACGGTTGCCGCGCCTGCGGGCAACGAAACGCCCGCGCCGGAATTGCAGGTGATCGAGGCGGCTTTTCA
GGGCGTCGAACTGGATGCGTTGCGGGCGACGGCGGATGCGATCGGTCAGTCGCGCAATCTCGTCGCCGGT
ATTGAAACGCTGCTCCTGGAGCAGGTCGGAGTCGGCGCGGCCCCCGACCTTGCCGCCCTCAATGCCGTCA
TCGCGGAGGCACAAAAGGCGGTCGCCGCGCCGCTCGCGCAACGCACCGGGCAACCGGTCGCGTCCGAGGA
TCTCCCGACCGAGCCCTCCTCGGCAGAGACTCCTGGGCTGACCCCCGGCGAGCGTTCCGTCGTGTCGACA
ACCCCCGGCGCCATCAAGACGCGCGGCGACGTCGTCCGCACACTCGAACTCCTGTGCGAATACTATCGGC
GCCAGGAACCCTCCAGCCCGATCCCCTTGTTACTCAACCGTGCCAAACGACTCGTCTCCAAGGATTTTCT
CGAAATCCTGCGAGATTTGGCGCCGGATGGTCTCGCGCAGGCGGAAGTGATTCGCGGACCGGACGCCGAC
GAATCCGCTTAA