SecReT6
Protein ID: 390950610
SecReT6 ID670
T6SS typei3
Gene symbol-
Locus tagThivi_2297
StrainThiocystis violascens DSM 198
Repliconchromosome [GenBank: NC_018012] [Browse all T6SS(s) in this replicon]
Location [Strand]2506519..2508669 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDI3YB76
KEGG IDtvi:Thivi_2297
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.50E-82, Aligned region: 30..324
Phage_base_V [PF04717], Evalue: 9.10E-24, Aligned region: 371..464
Protein Sequence: 716 a.a.     [Download]
>gi|390950610|ref|YP_006414369.1| Rhs element Vgr protein [Thiocystis violascens DSM 198]
MSSTQRYRPLSVNSTLGEDVLLLREMTAAERLSVPFEYALTLLSERLEIDPDDLLGTPMTVALLLPDGKR
RFYNGYVSRFSQTGFQGRHALYRAILVPWLWFLSRTADCRIFQDKTVPDIVKQVFRDHGFTDFEERLSGT
YRQWVYCVQYRETDLNFVSRLLEHEGIYYFFEHQDGKHTLVLADSVSAHAPVAGYAQVPFRHHEASVLRE
IEHLDDWILDKEVRSGAFSHNAFDFTAPKKNLLASRSSPGDHAMATLEVFDFQGDYTESADGATYARIRL
EEAQAAHEVAHATGNARGLTCGALFTLTEYPRTDQNREYLIVAANDLLQSDEFETSASLGEDEVFRCTLS
AIDSKVPYRPPRLTRKPVVQGSQTAIVVGKAGEEIWTDEYGRIKVLFHWDRYGRADEASSCWIRVAQIWA
GKGWGGIMTPRIGQEVIVDFLEGDPDQPIVTGRVYNKDCMPPYALPGEATKTSLKSSSSKGGGGFNEIRL
EDKKGSEQVFIHAEKNQDVRVKKDAFEWIGNERHLIVKSDQIEQVDGDKHLTLKGDQNEKVDGSVSLKVG
MDLQQKVGTKVGMDAGQEIHLKAGMNVVIEAGMSITLKAGGGFVVVGPAGVTISGTPVLINSGGSAGSGS
GCSPDAPKAAKEADKADPGKVSSAQAGTPPPASTLATTQVKAIAKASSSTGAGANPQAQALNAAAQSGTP
FCEKCEEARRAQAAQV
 
Nucleotide Sequence: 2151 bp     [Download]
>gi|390948458|ref|NC_018012.1|:c2508669-2506519 Thiocystis violascens DSM 198 chromosome, complete genome
ATGTCTTCAACTCAACGCTATCGTCCTTTGTCGGTCAATTCGACGCTCGGCGAGGATGTGCTGCTGCTGC
GCGAGATGACCGCCGCCGAGCGGCTCAGCGTCCCGTTCGAGTATGCGTTGACCCTGCTCTCCGAACGCCT
GGAGATCGACCCGGACGATCTTCTGGGCACGCCTATGACGGTGGCGCTCCTGCTGCCCGATGGCAAGCGA
CGTTTCTATAACGGCTATGTCAGCCGCTTTTCTCAGACCGGATTTCAAGGGCGCCATGCACTCTACCGGG
CGATCCTGGTGCCCTGGCTCTGGTTCCTGTCGCGCACCGCCGACTGCCGCATCTTTCAGGACAAAACCGT
TCCGGACATCGTGAAACAGGTCTTCCGCGATCATGGTTTTACCGACTTCGAGGAGCGGCTCTCGGGCACG
TATCGTCAATGGGTCTACTGCGTCCAGTACCGCGAGACCGACCTGAACTTCGTCAGCCGCCTGCTTGAGC
ATGAGGGTATCTACTATTTCTTCGAGCACCAGGATGGAAAACACACATTGGTGCTTGCCGACAGCGTGAG
CGCGCACGCGCCGGTTGCCGGCTATGCGCAGGTTCCCTTCAGGCATCACGAGGCGTCGGTGCTCCGCGAG
ATCGAGCATCTCGACGATTGGATCCTGGACAAGGAGGTGCGCTCGGGCGCCTTTTCCCACAACGCCTTCG
ACTTCACCGCGCCGAAGAAAAACCTGCTGGCCAGCAGAAGCAGTCCAGGCGATCACGCCATGGCAACGCT
AGAGGTCTTCGACTTTCAGGGCGACTATACCGAGTCCGCCGATGGCGCAACCTATGCGCGCATCCGTCTG
GAGGAGGCCCAGGCCGCGCATGAGGTTGCGCATGCGACCGGCAATGCCCGCGGCTTGACCTGCGGCGCCC
TGTTCACGCTGACGGAGTATCCGCGGACGGATCAGAATCGGGAATATTTGATCGTTGCCGCGAACGATTT
GCTGCAATCCGACGAGTTCGAGACCAGCGCATCCCTTGGCGAAGACGAGGTCTTCCGCTGCACCTTGAGC
GCCATCGACTCCAAGGTTCCCTACCGGCCGCCGCGCCTGACCCGCAAGCCCGTCGTCCAGGGTTCCCAGA
CCGCGATCGTCGTCGGCAAAGCGGGCGAGGAGATCTGGACGGACGAATACGGGCGGATCAAGGTGCTCTT
CCATTGGGATCGCTACGGTCGAGCCGACGAAGCCAGCTCCTGCTGGATCCGGGTGGCCCAGATCTGGGCG
GGCAAGGGTTGGGGTGGCATCATGACGCCGCGCATCGGTCAGGAGGTCATCGTCGATTTTCTGGAGGGCG
ATCCCGACCAGCCGATCGTCACCGGCAGGGTCTACAATAAAGACTGCATGCCGCCTTACGCCTTGCCGGG
AGAGGCCACTAAGACGAGCCTCAAGAGCAGTTCCAGCAAAGGGGGCGGCGGCTTCAACGAGATTCGCCTG
GAAGACAAGAAGGGCTCGGAGCAGGTCTTTATTCACGCCGAGAAGAACCAGGACGTTCGGGTCAAGAAGG
ATGCGTTCGAGTGGATCGGTAACGAGCGCCACCTGATCGTCAAGTCCGACCAGATCGAGCAGGTCGACGG
CGACAAACACCTGACCCTGAAGGGGGACCAGAACGAGAAGGTGGACGGATCCGTCTCGCTCAAGGTCGGG
ATGGATCTCCAACAGAAGGTCGGAACCAAGGTTGGGATGGACGCCGGACAGGAGATCCACCTGAAGGCCG
GCATGAACGTGGTGATCGAGGCCGGCATGAGCATCACGCTCAAGGCGGGCGGCGGCTTCGTGGTGGTCGG
GCCGGCCGGCGTGACCATCTCCGGGACGCCCGTGCTGATCAACAGCGGCGGCTCGGCCGGCTCCGGCTCC
GGGTGTTCCCCGGACGCGCCCAAGGCGGCCAAGGAGGCGGACAAGGCCGATCCTGGAAAGGTGTCGAGCG
CCCAGGCCGGCACGCCCCCGCCCGCCTCGACCCTCGCGACGACGCAGGTCAAGGCGATCGCCAAGGCCAG
TTCCAGCACTGGTGCCGGCGCCAATCCTCAGGCCCAGGCGTTGAATGCAGCCGCCCAAAGCGGGACGCCC
TTCTGCGAGAAATGCGAGGAGGCACGGCGCGCTCAGGCGGCCCAGGTTTGA