SecReT6
Protein ID: 390950611
SecReT6 ID670
T6SS typei3
Gene symbol-
Locus tagThivi_2298
StrainThiocystis violascens DSM 198
Repliconchromosome [GenBank: NC_018012] [Browse all T6SS(s) in this replicon]
Location [Strand]2508811..2510454 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDI3YB77
KEGG IDtvi:Thivi_2298
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.50E-13, Aligned region: 28..97
Protein Sequence: 547 a.a.     [Download]
>gi|390950611|ref|YP_006414370.1| FHA domain-containing protein [Thiocystis violascens DSM 198]
MEINLRVVNRQTQTFERDVRLSLTEEGVTLGRSPGNDLCLEDPERVVSGRHARLDPRDGGIWITDTSSNG
TYLNDAVDPLPSHQSVALHDGDRLIVGAYEITVTLGARPAAVAGSNPFSDLAASDDLPGLARVGGTADIL
DLLDPGGGRDQHQAPAGAMPSRSAERHLADDPFADAAPLNDVLAGPAADAPAREAPPRHTPVEHVFYRPA
EHQPVPDDYDLLSDAWTPAAPEPEPRPPSDLSQPSLAVPEPNGIETVTLDLNSLPSEASPAVMPPTPDFS
EPSPPAPVTHEPDTRDADRLDLSWAEAAPADLPPPRRPEPPRPGTIPQRVGSGSELEAFLTGLGTGNPAE
IEHPKELLQHAGELLRVLATGLTQTMMGRAQFKSELRLGVTTIRAAENNPFKFSVAADDILDRLLFRPTP
GFLPAVPAARSAFEDIQAHEMAMTAGLQAALRALLARFEPAELERRLSRRSGLDKVLPIARKARYWDLFT
ETYEQAAADAAEDFMQIFGDAFARAYQEQIRRLAESRGPRRGERGSDPRGRADSCGT
 
Nucleotide Sequence: 1644 bp     [Download]
>gi|390948458|ref|NC_018012.1|:2508811-2510454 Thiocystis violascens DSM 198 chromosome, complete genome
ATGGAGATAAATCTGCGCGTCGTGAACCGTCAGACCCAGACCTTTGAACGGGACGTCCGTCTGAGTCTGA
CCGAAGAGGGCGTGACCCTTGGCCGTAGCCCCGGCAATGACCTCTGTCTGGAAGATCCGGAGCGGGTGGT
TTCGGGGCGCCATGCCCGGCTCGATCCGCGCGACGGGGGGATCTGGATCACGGATACCAGCAGTAACGGC
ACCTATCTGAACGACGCCGTCGACCCCCTGCCCTCGCACCAATCCGTGGCCCTCCATGATGGCGACCGGT
TGATCGTCGGCGCCTACGAGATCACCGTCACGCTCGGTGCTAGACCGGCGGCGGTCGCCGGCAGCAACCC
CTTTTCCGACCTGGCCGCTTCCGATGACCTGCCAGGACTGGCGCGGGTTGGCGGCACAGCCGATATTCTG
GACCTTCTCGATCCCGGCGGCGGCCGTGACCAACACCAAGCCCCCGCAGGGGCGATGCCGTCTCGATCCG
CCGAACGGCACCTGGCCGATGACCCCTTCGCCGATGCCGCACCGCTCAATGACGTCCTGGCCGGCCCCGC
GGCGGACGCCCCGGCTCGGGAGGCGCCCCCTCGTCACACGCCGGTCGAACACGTCTTCTACCGCCCGGCC
GAGCATCAACCGGTTCCGGACGATTACGATCTCTTGAGCGACGCCTGGACGCCCGCCGCCCCGGAACCGG
AACCCAGACCGCCGTCAGACCTGTCGCAACCGTCACTGGCGGTTCCAGAACCGAACGGCATCGAGACCGT
CACTCTGGACTTGAACTCGCTGCCATCCGAGGCATCGCCGGCGGTCATGCCGCCAACGCCAGACTTCTCG
GAACCGTCGCCCCCGGCGCCGGTGACGCACGAACCGGACACGAGAGACGCCGACCGCCTGGATCTGTCGT
GGGCGGAGGCAGCGCCGGCGGACCTGCCGCCGCCACGGCGGCCGGAACCGCCGCGACCTGGAACAATACC
GCAGCGCGTCGGCTCGGGTAGCGAATTGGAGGCATTCCTGACCGGTCTTGGAACCGGCAACCCGGCGGAA
ATCGAGCACCCCAAGGAGTTGCTCCAGCATGCCGGGGAGTTGTTGCGCGTGCTCGCGACGGGTCTGACCC
AGACCATGATGGGGCGCGCCCAGTTCAAAAGCGAGTTGCGGCTTGGCGTCACGACGATTCGCGCCGCCGA
GAATAACCCTTTCAAGTTTTCGGTCGCAGCGGACGATATCCTGGATCGTCTGCTGTTTCGCCCGACACCG
GGATTCCTGCCGGCGGTGCCGGCGGCGCGCTCGGCCTTCGAGGACATCCAGGCCCATGAGATGGCCATGA
CGGCCGGGCTGCAGGCGGCCCTGCGCGCGCTCCTGGCCCGCTTCGAGCCCGCCGAGCTTGAACGCCGTCT
CAGCCGCCGCTCCGGGCTCGACAAGGTGCTGCCGATCGCCCGCAAGGCCAGATACTGGGATCTCTTTACC
GAGACCTACGAACAGGCCGCCGCCGACGCCGCGGAGGATTTCATGCAGATCTTCGGCGACGCCTTCGCGC
GCGCCTATCAGGAGCAGATTCGGCGTCTCGCCGAGTCGCGAGGGCCGCGGCGGGGCGAACGCGGTTCCGA
TCCTCGCGGCCGGGCCGATTCCTGCGGTACATGA