SecReT6
Protein ID: 390950612
SecReT6 ID670
T6SS typei3
Gene symbol-
Locus tagThivi_2299
StrainThiocystis violascens DSM 198
Repliconchromosome [GenBank: NC_018012] [Browse all T6SS(s) in this replicon]
Location [Strand]2510451..2511002 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDI3YB78
KEGG IDtvi:Thivi_2299
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.50E-39, Aligned region: 37..178
Protein Sequence: 183 a.a.     [Download]
>gi|390950612|ref|YP_006414371.1| type VI secretion lipoprotein [Thiocystis violascens DSM 198]
MTWIRAILYQRIQTREQVILSSQRRPIGCAFAGLAFILLTGCGGKPTLPPVPSEKPPLQLRVEVAAAPDA
NRNPGGKPLSVVVRLYELKSQGVFAKADFFSLYDREGEVLGGDLIARDEVTLAPGQFLPIARPLNPEATY
LGVIAAFREIDQARWRDLMRLKPGMDNTLLVEVGANAVSIRHR
 
Nucleotide Sequence: 552 bp     [Download]
>gi|390948458|ref|NC_018012.1|:2510451-2511002 Thiocystis violascens DSM 198 chromosome, complete genome
ATGACCTGGATCCGGGCCATACTCTATCAACGAATTCAGACACGAGAGCAGGTTATCTTGAGCAGTCAAC
GCCGACCGATCGGTTGCGCCTTTGCGGGCCTGGCCTTTATTCTCCTGACAGGATGCGGCGGCAAGCCAAC
GCTGCCGCCAGTGCCGTCGGAGAAACCGCCATTGCAACTGCGCGTCGAGGTCGCCGCCGCGCCGGATGCC
AATCGCAATCCCGGCGGCAAGCCATTGTCCGTGGTGGTGCGCCTCTATGAACTCAAAAGCCAGGGCGTGT
TTGCCAAGGCGGATTTCTTCAGCCTCTATGATCGCGAGGGCGAGGTGCTAGGCGGCGATCTGATTGCCCG
TGACGAGGTCACCCTGGCCCCCGGTCAATTTCTGCCGATCGCGCGCCCGCTCAATCCCGAGGCGACCTAT
CTCGGCGTCATCGCGGCCTTCCGCGAGATCGACCAGGCGCGCTGGCGCGATCTGATGCGCCTGAAACCAG
GCATGGACAACACCCTTCTGGTCGAGGTCGGCGCCAACGCCGTCTCGATCCGTCACCGATAG