SecReT6
Protein ID: 390950613
SecReT6 ID670
T6SS typei3
Gene symbol-
Locus tagThivi_2300
StrainThiocystis violascens DSM 198
Repliconchromosome [GenBank: NC_018012] [Browse all T6SS(s) in this replicon]
Location [Strand]2511012..2512346 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDI3YB79
KEGG IDtvi:Thivi_2300
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.10E-146, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|390950613|ref|YP_006414372.1| type VI secretion protein [Thiocystis violascens DSM 198]
MAWDNKVLWSEGLFLQPQHLQQHDRYLEHLIGARSGIGIPSAWGLRRLRIDVELLAFGKFALAEVAGTLP
DGTPFDAPASDPLPPPLDFDENVSAQTLYLALPLRRPGATESGGPGETETVLRYRSSELTVRDNTLGSDT
ETQLDIGRLDLRLMAERQTRDGYACCGVGRVLECRADRQILLDSAYIPPCVDVQASPRLADFIEELTGLL
HRQAETRAGRVRGAGRGGVADWSDFLLLQLMNRAEPVVLHLTRIQGLHPEAIYRYLLGLAGELATFASEA
KRPPDFPPYRHEDLDASFTPLIDRLRDYLNREYAERAIQIPIKERQFGFRIALVDDRSLLAGSRFVLAAQ
ANLDSQTLRNRLPAQTKIGPVDKIQELVKLALPGIALRPMPTAPLEIPYHEGFDYFELDRASEFWKQLVS
GGGFGLHIGGEFPALKLELWAIRE
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|390948458|ref|NC_018012.1|:2511012-2512346 Thiocystis violascens DSM 198 chromosome, complete genome
GTGGCCTGGGATAACAAGGTTCTGTGGTCCGAGGGTCTGTTCCTTCAGCCGCAACATCTCCAGCAGCACG
ATCGTTATCTCGAACATCTGATCGGGGCCAGATCGGGCATCGGCATCCCCTCCGCCTGGGGTCTGCGCCG
TCTGCGGATCGACGTGGAATTGCTCGCGTTCGGGAAATTCGCGCTCGCCGAGGTCGCGGGCACGCTGCCC
GACGGAACCCCCTTCGACGCCCCGGCGAGCGACCCGCTGCCGCCGCCGCTGGACTTCGACGAGAACGTCA
GCGCCCAGACCCTCTATCTCGCGCTGCCACTGCGCCGCCCCGGCGCGACCGAGAGTGGCGGCCCCGGCGA
GACCGAAACCGTCCTGCGCTATCGCTCCAGCGAACTCACGGTGCGCGATAACACGCTGGGCTCGGACACC
GAAACGCAACTCGATATTGGCCGACTCGATCTGCGCCTGATGGCGGAGCGCCAGACCCGCGATGGCTATG
CCTGTTGCGGGGTCGGGCGCGTACTCGAATGCCGCGCCGATCGTCAGATCCTGCTCGACTCCGCCTACAT
TCCGCCCTGCGTCGACGTTCAAGCGTCCCCGCGGCTGGCCGATTTCATCGAGGAGTTGACGGGGCTGCTC
CATCGCCAGGCCGAGACGCGCGCCGGTCGGGTGCGTGGCGCCGGACGCGGCGGGGTCGCGGACTGGTCCG
ACTTTCTGCTGCTGCAATTGATGAACCGGGCCGAGCCCGTCGTCCTGCATCTGACCCGGATCCAGGGACT
GCATCCAGAGGCCATCTATCGTTACCTGCTCGGCCTGGCCGGGGAACTGGCGACCTTCGCCAGCGAGGCG
AAGCGCCCGCCGGACTTCCCGCCCTACCGGCATGAGGATCTGGACGCCAGCTTCACGCCCCTGATCGACC
GACTGCGCGACTATCTGAACCGCGAATATGCCGAACGCGCCATCCAGATCCCGATCAAGGAGCGTCAATT
CGGGTTCCGCATCGCGTTGGTGGACGACCGGTCGCTTCTCGCGGGATCACGTTTCGTGCTCGCCGCCCAG
GCGAATCTGGACTCCCAGACCCTGCGCAACCGCCTCCCCGCGCAGACCAAGATCGGCCCGGTGGACAAGA
TTCAGGAACTGGTCAAGCTCGCCCTGCCCGGGATCGCGCTCCGCCCCATGCCGACCGCCCCATTGGAGAT
TCCCTATCACGAGGGTTTCGATTATTTTGAACTGGATCGCGCCAGCGAATTCTGGAAGCAGTTGGTGTCG
GGTGGCGGCTTCGGCCTGCATATCGGCGGTGAATTCCCGGCGCTGAAACTTGAACTCTGGGCCATCCGAG
AGTAA