SecReT6
Protein ID: 390950614
SecReT6 ID670
T6SS typei3
Gene symbol-
Locus tagThivi_2301
StrainThiocystis violascens DSM 198
Repliconchromosome [GenBank: NC_018012] [Browse all T6SS(s) in this replicon]
Location [Strand]2512350..2513735 [+]
ProductDotU family type IV / VI secretion system protein
NoteTssL
UniProt IDI3YB80
KEGG IDtvi:Thivi_2301
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.40E-67, Aligned region: 59..264
OmpA [PF00691], Evalue: 1.50E-12, Aligned region: 341..437
Protein Sequence: 461 a.a.     [Download]
>gi|390950614|ref|YP_006414373.1| DotU family type IV / VI secretion system protein [Thiocystis violascens DSM 198]
MTDEDPFATAGDAGHTIIRPMPGGRRVPGQPTPPPVPTPAVSGTLPGWNPETLPAHLNNPLVGCASGLLT
VAAQVRGTSSHPDPEGLREGLTRQIREFEACARARGFADAVVLPARYVLCSLIDESVLDTPWGSQSVWSN
RGLLISFHNEAWGGEKFFTALERLLAYPSGNLILLELLYLCLALGFEGRYRVREGGRDQLNRVREQLFQT
IRAQRGDPELELSPHWRGIQEQRDPLIHQLPLWVFSAVSTLLLLALFAYFTFTLNRDSDPVYLSLGNLDK
RLPALTERPRMPLTEAPPPDEPGATAPLTLRILLADEIAARQLDVVDRPQGQTVIIRGDDLFASGSVTVK
PPYLPLLRRIAESLAQLPGAVLVTGHTDSVPIKTLRFPSNWHLSQERANKVRDLLVEVAGNPARFTAEGR
ADVDPLIAGSPKDARNRRVEVMLMTPARRSGEPTSRTGTSR
 
Nucleotide Sequence: 1386 bp     [Download]
>gi|390948458|ref|NC_018012.1|:2512350-2513735 Thiocystis violascens DSM 198 chromosome, complete genome
ATGACCGACGAGGATCCCTTTGCGACCGCTGGCGATGCCGGCCATACGATCATCCGCCCGATGCCGGGCG
GGCGGCGCGTCCCCGGTCAGCCAACGCCCCCGCCCGTACCGACGCCGGCGGTCTCCGGCACCCTACCCGG
CTGGAATCCCGAGACGCTGCCGGCACATCTGAACAATCCACTGGTCGGCTGCGCCAGCGGACTTCTCACG
GTAGCGGCTCAGGTGCGCGGCACCTCCTCCCATCCGGACCCCGAAGGTCTGCGCGAGGGACTGACCCGGC
AGATACGCGAGTTCGAAGCCTGCGCGCGCGCCCGGGGGTTCGCGGATGCCGTGGTGCTACCCGCGCGGTA
TGTGCTGTGCTCGCTGATCGATGAATCGGTCTTGGATACCCCGTGGGGAAGTCAGAGCGTGTGGAGCAAC
CGCGGACTCCTCATCAGCTTCCACAACGAAGCCTGGGGCGGGGAAAAATTCTTCACCGCGCTCGAACGCC
TCCTGGCCTATCCCAGCGGCAACCTGATTCTGCTGGAACTTCTGTATCTCTGTCTCGCGCTCGGTTTCGA
GGGTCGTTACCGGGTGCGCGAGGGCGGACGGGATCAACTCAATCGGGTGCGCGAGCAGCTCTTTCAGACC
ATCCGCGCGCAACGCGGCGATCCCGAACTCGAACTCTCACCCCATTGGCGAGGCATCCAAGAGCAACGCG
ACCCGCTGATCCATCAGCTTCCGCTCTGGGTCTTCTCCGCGGTTTCGACGCTGCTCCTGCTGGCGCTGTT
CGCCTATTTTACCTTCACGCTCAACCGCGACTCGGACCCCGTGTATCTGTCGCTCGGCAACCTGGACAAG
CGGCTGCCGGCGTTGACCGAACGGCCTCGCATGCCCCTGACCGAGGCGCCGCCGCCGGACGAACCGGGCG
CGACGGCGCCGCTGACGCTGCGCATCCTGCTCGCCGACGAGATCGCCGCGCGGCAACTGGACGTGGTCGA
CCGTCCGCAGGGCCAGACCGTCATCATTCGCGGCGACGATCTCTTCGCCTCGGGCAGCGTGACGGTCAAG
CCGCCGTATCTTCCGCTCCTTCGGCGCATCGCCGAATCGCTGGCGCAATTGCCCGGCGCGGTGCTGGTGA
CGGGCCACACCGACAGCGTCCCAATCAAGACCCTGCGCTTTCCCTCCAACTGGCATCTCTCGCAGGAACG
GGCAAACAAGGTCCGCGATCTGCTCGTCGAGGTCGCGGGAAACCCCGCCCGCTTCACCGCCGAGGGCCGC
GCCGATGTCGATCCGCTGATCGCCGGGAGCCCCAAAGACGCCCGTAACCGACGGGTTGAGGTCATGCTCA
TGACGCCGGCTCGCCGCAGCGGCGAGCCCACCTCGCGCACGGGGACGAGTCGATGA