SecReT6
Protein ID: 392419217
SecReT6 ID671
T6SS typei1
Gene symbol-
Locus tagA458_00650
StrainPseudomonas stutzeri CCUG 29243
Repliconchromosome [GenBank: NC_018028] [Browse all T6SS(s) in this replicon]
Location [Strand]127648..129726 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDI4CMU1
KEGG IDpsc:A458_00650
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.40E-71, Aligned region: 29..323
Phage_GPD [PF05954], Evalue: 1.40E-71, Aligned region: 521..562
Phage_base_V [PF04717], Evalue: 4.30E-25, Aligned region: 371..464
Protein Sequence: 692 a.a.     [Download]
>gi|392419217|ref|YP_006455821.1| Rhs element Vgr protein [Pseudomonas stutzeri CCUG 29243]
MFNPANQAPFTLSLEGVEHDFKVLEFRGREAISQPYRFDLELVSERPELDLERLLHRPAFLAFAPGGSGI
HGLVHQAAQGQSGQRLTRYRLTIVPQLAYLAHRTNQRIFQHLSVPQIVAQVLEEHGIQADAYRFQLGPVI
YPPREYCVQYDETDLHFIQRLCEEEGIHYHFQHSAAGHALVFGDDQTVFPRLAATAYQQDSGLVADQPVI
KRFGLRLETRTSRVTRRDYDFEKPRLTMEAAFHSDFQPDLEDYDYPGRFTERARGKHLSQRALERHRHDY
ELAEGESDQPQLASGHFLPLGEHPRSDWNQLWLLTEVLHEGKQPQVLEESVTSDSQSRDGFTQGYRNHFT
ATPWDIPFRPALNHPKPKVLGSQTAVVTGPAGEEIHCDEYGRVRVQFHWDRHGQADDKTSCWLRVSSSWA
GDRYGGIAIPRVGMEVLVTFLEGDPDQPLVTGCLYHKEHQVPYDLPANKTRTVFKTLSSPGGGGYNELRI
EDRKGAEQIYLHAQRDWDENIEHDQKIRVGHERHDTVEANSYSEFRAEEHRTTHADRKIEIRANDHLTVG
NTQHLKIGTGQFIEAGNEIHYYAGSKVVIDAGMELTASGGGSFLKLDPSGVTLSGATIRMNSGSSAGTGS
GVNVISPRIPWAADQDKAGAKPKLALANTQLQLARQARQIAASRCPICEACRAGMCEVGGGR
 
Nucleotide Sequence: 2079 bp     [Download]
>gi|392419087|ref|NC_018028.1|:c129726-127648 Pseudomonas stutzeri CCUG 29243 chromosome, complete genome
ATGTTCAACCCCGCCAATCAGGCTCCCTTCACGCTATCCCTCGAAGGCGTCGAGCACGACTTCAAGGTGC
TCGAATTCCGGGGCCGCGAAGCCATCAGCCAGCCCTATCGCTTCGACCTGGAGCTGGTCAGCGAGCGCCC
CGAACTGGATCTGGAACGCCTGCTGCATCGCCCGGCCTTCCTCGCCTTCGCGCCGGGTGGCAGCGGTATT
CATGGGCTGGTGCATCAGGCCGCCCAGGGTCAGTCCGGCCAGCGCCTGACCCGCTATCGGCTGACGATCG
TGCCGCAGCTGGCCTACCTCGCCCATCGCACCAACCAGCGCATCTTCCAGCACCTGAGCGTGCCGCAGAT
CGTCGCCCAGGTGCTCGAGGAGCATGGCATCCAGGCCGATGCCTACCGCTTCCAGCTCGGCCCGGTGATT
TACCCGCCGCGCGAATATTGCGTGCAGTACGACGAAACCGACCTGCACTTCATCCAGCGCCTGTGCGAGG
AAGAGGGCATTCACTATCACTTCCAGCACAGCGCGGCCGGTCATGCCCTGGTCTTCGGCGATGACCAGAC
CGTCTTCCCCAGGCTCGCTGCCACCGCCTATCAGCAGGACAGCGGCCTGGTCGCCGACCAGCCGGTGATC
AAGCGCTTCGGCCTTCGTCTGGAAACCCGCACCAGCCGCGTCACGCGCCGCGATTACGATTTCGAGAAGC
CACGTCTGACTATGGAAGCCGCGTTCCACAGCGACTTCCAGCCCGACCTTGAAGACTACGATTACCCCGG
CCGCTTCACCGAGCGCGCCCGCGGCAAGCACCTGTCGCAACGCGCCCTGGAACGCCATCGCCACGACTAC
GAGCTGGCCGAAGGCGAAAGCGACCAGCCGCAACTGGCGAGTGGGCACTTCCTCCCGCTCGGCGAACACC
CCCGCAGCGACTGGAACCAGCTCTGGCTGCTGACCGAGGTGCTGCATGAAGGTAAGCAGCCACAGGTGTT
GGAGGAGTCGGTCACGAGCGATAGCCAGTCACGTGACGGCTTCACTCAGGGCTACCGCAACCACTTCACC
GCCACCCCCTGGGACATCCCCTTCCGCCCGGCGCTGAACCATCCGAAGCCGAAGGTTCTCGGCAGCCAGA
CCGCCGTGGTCACCGGCCCCGCTGGCGAAGAGATCCACTGCGACGAGTACGGCCGCGTGCGCGTCCAGTT
CCACTGGGACCGCCACGGCCAGGCCGACGACAAGACCAGCTGCTGGCTGCGCGTGTCGTCCAGCTGGGCC
GGCGACCGCTACGGCGGCATCGCCATCCCCCGCGTTGGCATGGAAGTGCTGGTGACCTTCCTCGAAGGCG
ACCCCGATCAACCGCTGGTGACCGGTTGCCTCTACCACAAGGAACACCAGGTTCCCTACGACCTGCCGGC
GAACAAGACCCGTACGGTGTTCAAGACCCTGAGTTCCCCAGGCGGTGGCGGATACAACGAACTGCGCATC
GAAGACCGCAAGGGCGCCGAGCAGATCTACCTCCACGCCCAGCGCGACTGGGACGAGAACATCGAGCACG
ACCAGAAGATCCGCGTCGGCCACGAACGCCACGACACCGTGGAAGCCAACAGCTACAGCGAATTTCGCGC
CGAAGAACACCGCACCACCCACGCCGACCGCAAAATCGAAATCCGCGCCAACGACCACCTCACCGTGGGC
AATACCCAGCACCTGAAGATCGGCACTGGGCAATTCATCGAGGCGGGCAACGAGATCCACTACTACGCCG
GCAGCAAGGTCGTCATCGACGCCGGCATGGAACTCACCGCCTCCGGCGGAGGCAGCTTCCTCAAACTCGA
CCCCAGCGGGGTGACGCTGAGCGGTGCGACGATCCGGATGAATTCGGGTAGCTCGGCTGGCACCGGTTCA
GGCGTGAACGTCATCTCTCCCCGGATTCCCTGGGCAGCCGACCAAGACAAAGCCGGCGCCAAGCCCAAGC
TCGCGCTGGCCAATACCCAACTGCAGCTGGCGCGCCAGGCCCGGCAAATTGCCGCCAGCCGTTGCCCGAT
CTGCGAAGCGTGCCGGGCGGGGATGTGTGAAGTGGGAGGCGGCCGATGA