SecReT6
Protein ID: 392419219
SecReT6 ID671
T6SS typei1
Gene symbol-
Locus tagA458_00660
StrainPseudomonas stutzeri CCUG 29243
Repliconchromosome [GenBank: NC_018028] [Browse all T6SS(s) in this replicon]
Location [Strand]131261..133852 [-]
ProductATPase
NoteTssH
UniProt IDI4CMU3
KEGG IDpsc:A458_00660
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.20E-42, Aligned region: 206..227
AAA_2 [PF07724], Evalue: 1.20E-42, Aligned region: 597..762
AAA [PF00004], Evalue: 7.40E-19, Aligned region: 208..339
AAA [PF00004], Evalue: 7.40E-19, Aligned region: 602..720
AAA_5 [PF07728], Evalue: 9.70E-13, Aligned region: 208..228
AAA_5 [PF07728], Evalue: 9.70E-13, Aligned region: 306..338
AAA_5 [PF07728], Evalue: 9.70E-13, Aligned region: 601..720
AAA_16 [PF13191], Evalue: 6.50E-12, Aligned region: 185..228
AAA_16 [PF13191], Evalue: 6.50E-12, Aligned region: 252..286
AAA_16 [PF13191], Evalue: 6.50E-12, Aligned region: 435..532
AAA_16 [PF13191], Evalue: 6.50E-12, Aligned region: 575..625
AAA_16 [PF13191], Evalue: 6.50E-12, Aligned region: 666..695
AAA_16 [PF13191], Evalue: 6.50E-12, Aligned region: 759..828
ClpB_D2-small [PF10431], Evalue: 1.70E-08, Aligned region: 771..840
AAA_22 [PF13401], Evalue: 3.30E-08, Aligned region: 207..303
AAA_22 [PF13401], Evalue: 3.30E-08, Aligned region: 600..706
NACHT [PF05729], Evalue: 9.20E-06, Aligned region: 208..235
NACHT [PF05729], Evalue: 9.20E-06, Aligned region: 601..642
NACHT [PF05729], Evalue: 9.20E-06, Aligned region: 801..829
Clp_N [PF02861], Evalue: 3.90E-05, Aligned region: 31..72
Clp_N [PF02861], Evalue: 3.90E-05, Aligned region: 102..122
AAA_25 [PF13481], Evalue: 5.10E-05, Aligned region: 208..232
AAA_25 [PF13481], Evalue: 5.10E-05, Aligned region: 264..304
AAA_25 [PF13481], Evalue: 5.10E-05, Aligned region: 598..633
IstB_IS21 [PF01695], Evalue: 6.00E-05, Aligned region: 201..232
IstB_IS21 [PF01695], Evalue: 6.00E-05, Aligned region: 601..619
Sigma54_activat [PF00158], Evalue: 6.10E-05, Aligned region: 202..222
Sigma54_activat [PF00158], Evalue: 6.10E-05, Aligned region: 601..720
AAA_17 [PF13207], Evalue: 0.00012, Aligned region: 208..252
AAA_17 [PF13207], Evalue: 0.00012, Aligned region: 464..464
AAA_17 [PF13207], Evalue: 0.00012, Aligned region: 600..636
AAA_19 [PF13245], Evalue: 0.0002, Aligned region: 205..230
AAA_19 [PF13245], Evalue: 0.0002, Aligned region: 598..628
AAA_29 [PF13555], Evalue: 0.00057, Aligned region: 202..224
AAA_29 [PF13555], Evalue: 0.00057, Aligned region: 599..626
ResIII [PF04851], Evalue: 0.0013, Aligned region: 190..229
ResIII [PF04851], Evalue: 0.0013, Aligned region: 278..289
ResIII [PF04851], Evalue: 0.0013, Aligned region: 601..634
DUF258 [PF03193], Evalue: 0.0037, Aligned region: 177..225
DUF258 [PF03193], Evalue: 0.0037, Aligned region: 600..612
AAA_14 [PF13173], Evalue: 0.004, Aligned region: 208..350
AAA_14 [PF13173], Evalue: 0.004, Aligned region: 600..695
AAA_18 [PF13238], Evalue: 0.0042, Aligned region: 208..228
AAA_18 [PF13238], Evalue: 0.0042, Aligned region: 602..643
Arch_ATPase [PF01637], Evalue: 0.0061, Aligned region: 188..222
Arch_ATPase [PF01637], Evalue: 0.0061, Aligned region: 260..292
Arch_ATPase [PF01637], Evalue: 0.0061, Aligned region: 600..613
Arch_ATPase [PF01637], Evalue: 0.0061, Aligned region: 672..682
SRP54 [PF00448], Evalue: 0.0079, Aligned region: 208..230
SRP54 [PF00448], Evalue: 0.0079, Aligned region: 600..622
Protein Sequence: 863 a.a.     [Download]
>gi|392419219|ref|YP_006455823.1| ATPase [Pseudomonas stutzeri CCUG 29243]
MINVDLQQLVLALDAKTKRDLEGAAERCVVRGGSKILVEDLLLGLLERPDGLLKRALLDAEVDAGALAQA
LQPRGERSESRNPVFSTELVQWLQDALLVASLELGQSQIDQAALILALLRNPLRYAGSHYQPLLARLDAE
RLRDFALSQQPQTANSKPAAGGESNLSRFTYNFTQQARDGKLDPVLCRDSAIRQMIDILARRRKNNPIVV
GEAGVGKTAIVEGLALRIASGEVPAALKGVELLCLDLGLLQAGASVKGEFERRLQGVIDEVKGSPKPIIL
FIDEAHTLIGAGGQAGSGDAANLLKPALARGELRTIAATTWSEYKKYFEKDPALARRFQPVQLHEPSVSE
AVTILRGLAPVYEKSHGIYLRDDAVTAAAELSARYLAGRQLPDKAVDVLDTACARVRISLAAAPEALERL
RGEVAEGERQREAMRRDLAAGLPVDAAALERLEQRLIAAGAEIEQLETRWTNQRELAERLLDLRKRTAEA
RSDANTDGEAPSLNELEAELRAVQTELAGAQAEQRLVSHEVCPRLVAEVISHWTGVPLSQLAREHNAQVA
SFAADLRARVRGQEQAVGALDRAMRAAAAGLNKPDAPVGVFLLVGPSGVGKTETALALADLLYGGERFLT
VINMSEFQEKHSVSRLIGAPPGYVGYGEGGMLTEAVRQKPYSVILLDEVEKADPDVMNVFYQIFDKGVAN
DGEGREINFRNTLILMTSNLASERIASFCSAGQRPAAEDLVLAIRPRLSQHFKPALLGRMRVVPYYPIAG
EVLDELVMLKLARFGERLQRRQLQFSHCPALVTHLSERCCNSDSGARLIDHLIEQHLQPLVVDRLLDAMA
SGEPLQRVHATLDGDGALVCEFA
 
Nucleotide Sequence: 2592 bp     [Download]
>gi|392419087|ref|NC_018028.1|:c133852-131261 Pseudomonas stutzeri CCUG 29243 chromosome, complete genome
ATGATCAATGTCGACTTGCAACAGCTGGTACTAGCACTAGACGCCAAAACCAAACGCGACTTGGAAGGCG
CCGCCGAACGCTGCGTGGTACGTGGCGGCAGCAAGATTCTCGTCGAGGATCTGCTGCTCGGCCTGCTCGA
GCGTCCCGATGGATTGCTCAAGCGAGCCTTGCTAGACGCCGAAGTGGATGCCGGCGCACTGGCGCAGGCG
CTACAACCGCGAGGCGAGCGCAGCGAATCGCGCAACCCGGTCTTTTCCACCGAACTGGTGCAATGGCTGC
AGGATGCCCTGCTGGTGGCCAGCCTGGAACTCGGCCAGAGCCAGATCGACCAGGCCGCGCTGATCCTCGC
GCTGCTGCGCAATCCGCTGCGCTATGCCGGCAGCCATTACCAGCCATTGCTGGCCCGACTGGATGCCGAG
CGCCTGCGCGACTTCGCCCTCAGCCAGCAGCCGCAGACTGCGAACAGCAAGCCGGCCGCCGGTGGCGAGT
CGAACCTGTCACGCTTTACCTACAACTTCACCCAGCAGGCCCGCGACGGCAAGCTCGACCCGGTGCTCTG
CCGCGACTCGGCAATCCGCCAGATGATCGACATCCTCGCCCGACGGCGGAAGAACAATCCGATCGTGGTC
GGCGAGGCCGGGGTCGGCAAGACCGCCATCGTCGAAGGCCTGGCGCTGCGTATCGCCAGCGGGGAAGTGC
CAGCGGCACTCAAGGGCGTCGAACTGCTCTGCCTGGACCTCGGCCTGCTGCAAGCCGGTGCCAGCGTAAA
GGGCGAATTCGAACGCCGTCTGCAGGGCGTGATCGACGAGGTCAAAGGCTCGCCAAAGCCGATCATCCTG
TTCATCGACGAGGCGCACACCCTGATCGGCGCCGGCGGCCAGGCCGGCAGCGGCGATGCGGCCAACCTGC
TCAAGCCCGCGTTGGCGCGCGGCGAGCTGCGCACCATCGCTGCGACGACCTGGAGCGAGTACAAGAAATA
CTTCGAGAAGGACCCGGCCCTGGCCCGTCGCTTCCAGCCGGTACAACTGCACGAGCCGAGCGTTTCGGAA
GCCGTCACCATCCTGCGCGGGCTGGCGCCGGTCTACGAAAAGAGTCACGGCATCTACCTGCGCGACGATG
CGGTCACGGCCGCCGCCGAACTGTCGGCGCGCTACCTGGCCGGCCGGCAGCTGCCGGACAAGGCCGTCGA
CGTGCTGGATACCGCCTGCGCGCGGGTGCGCATCAGCCTCGCTGCCGCGCCCGAGGCGCTGGAACGCCTG
CGTGGCGAGGTTGCCGAAGGCGAGCGCCAGCGTGAAGCCATGCGCCGCGATCTGGCCGCCGGCCTGCCGG
TCGACGCGGCTGCTCTCGAGCGGCTGGAGCAACGCCTGATCGCGGCGGGTGCGGAGATTGAGCAGCTGGA
AACTCGCTGGACGAATCAACGCGAGCTCGCCGAGCGCCTGCTCGATCTGCGCAAGCGCACAGCCGAAGCC
CGCAGCGATGCGAACACGGACGGCGAGGCCCCATCGCTCAACGAATTAGAGGCCGAGCTGCGCGCCGTGC
AAACCGAACTCGCCGGAGCCCAGGCCGAGCAGCGACTGGTCAGCCATGAGGTCTGCCCGCGCCTGGTGGC
CGAGGTGATCAGCCACTGGACCGGCGTGCCGCTGTCGCAGCTGGCCCGTGAACACAACGCGCAAGTCGCC
AGCTTCGCCGCCGATCTGCGCGCGCGGGTGCGCGGTCAGGAACAGGCTGTCGGGGCGCTGGACCGCGCCA
TGCGCGCCGCTGCGGCCGGCCTGAACAAGCCCGACGCGCCGGTGGGTGTGTTTCTGCTGGTCGGCCCCAG
CGGTGTCGGCAAGACCGAAACCGCCCTGGCCCTGGCCGACCTGCTGTACGGCGGCGAGCGTTTCCTCACT
GTGATCAACATGTCCGAATTCCAGGAGAAACACAGCGTTTCCCGCCTGATCGGCGCACCTCCGGGTTATG
TCGGCTACGGCGAAGGCGGCATGCTCACCGAAGCCGTGCGGCAGAAACCCTACTCGGTGATCCTGCTCGA
CGAGGTGGAGAAGGCCGACCCGGATGTGATGAACGTCTTCTACCAGATCTTCGACAAGGGCGTGGCGAAT
GACGGCGAGGGCCGCGAGATCAACTTCCGCAACACCCTGATCCTGATGACCAGCAACCTTGCCAGCGAGC
GCATCGCCAGTTTCTGCAGCGCCGGGCAGCGGCCGGCGGCCGAGGATCTGGTACTGGCCATCCGTCCGCG
GCTGTCGCAGCACTTCAAGCCGGCCCTGCTCGGGCGCATGCGCGTGGTGCCCTATTACCCGATCGCCGGG
GAGGTGCTCGACGAGCTGGTCATGCTCAAGCTGGCACGCTTCGGTGAGCGCCTGCAGCGTCGCCAGCTGC
AGTTCAGCCACTGCCCGGCGCTGGTCACGCACCTCTCCGAGCGCTGCTGCAACAGCGACAGCGGTGCGCG
CCTGATCGACCATCTGATCGAGCAGCACCTGCAACCACTAGTGGTGGACCGCCTGCTCGATGCCATGGCC
AGTGGCGAGCCGCTGCAGCGGGTGCATGCCACGCTGGATGGCGACGGCGCGCTGGTCTGTGAGTTCGCCT
GA