SecReT6
Protein ID: 392419220
SecReT6 ID671
T6SS typei1
Gene symbol-
Locus tagA458_00665
StrainPseudomonas stutzeri CCUG 29243
Repliconchromosome [GenBank: NC_018028] [Browse all T6SS(s) in this replicon]
Location [Strand]133864..134871 [-]
Producthypothetical protein
NoteTssG
UniProt IDI4CMU4
KEGG IDpsc:A458_00665
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.10E-85, Aligned region: 19..321
Protein Sequence: 335 a.a.     [Download]
>gi|392419220|ref|YP_006455824.1| hypothetical protein A458_00665 [Pseudomonas stutzeri CCUG 29243]
MDAAHGSATAALKPLNRGIREYSLFQGVLLVLDRLRQLDPGLDDEALYERLEFQANPSLGFPGSDIEQVQ
FFQEHGEWRARLRINLVSLFGAGSPLPAFYGEQALGDSEDGNPTRDFLDLFNNRLQRLLLPIWQKYRYRA
RFTSGAHDPFSEQLFALVGLSGEAIRNAPELNWKRLLPYLGLLSLRAHSAALIESVLRYYFKHAELNIEQ
CLERQVEILGEQRNRLGQANSQLGESLVLGERVRDRGGKFRIHIRQLDWNRFHEFLPIGSGYQPLCALVR
FTLRDPLDYDLRLELRPDEIRELRIGAANNCRLGWTSWLGRERADGLVTLGSKTH
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|392419087|ref|NC_018028.1|:c134871-133864 Pseudomonas stutzeri CCUG 29243 chromosome, complete genome
ATGGACGCCGCGCATGGGTCAGCAACCGCTGCTCTGAAACCGCTCAACCGCGGCATCCGCGAGTACAGCC
TGTTCCAGGGCGTGCTGCTGGTGCTTGATCGCCTCCGTCAGCTCGACCCCGGCCTGGATGACGAGGCGCT
CTACGAGCGCCTGGAGTTTCAGGCGAACCCGAGCCTGGGCTTTCCCGGCAGCGATATCGAGCAGGTGCAG
TTCTTCCAGGAGCATGGCGAGTGGCGCGCGCGCCTGCGCATCAACCTGGTCAGCCTGTTCGGCGCCGGCT
CGCCGCTACCGGCTTTCTACGGCGAACAGGCGCTTGGCGACAGCGAGGACGGCAACCCGACCCGCGACTT
TCTCGACCTGTTCAACAACCGCCTGCAGCGCCTGCTGCTGCCGATCTGGCAGAAATATCGCTACCGCGCC
CGCTTCACCAGCGGCGCCCATGACCCCTTCTCGGAGCAGCTGTTCGCTCTGGTCGGACTCAGCGGCGAGG
CCATCCGCAACGCGCCAGAGCTGAACTGGAAGCGCCTGCTGCCCTATCTCGGCCTGCTCAGCCTGCGCGC
GCACTCGGCGGCATTAATCGAATCGGTGCTGCGCTACTACTTCAAGCACGCCGAGCTGAACATCGAACAA
TGCCTGGAGCGCCAGGTGGAAATCCTCGGCGAACAACGCAACCGCCTCGGCCAGGCCAACAGCCAGCTGG
GCGAGAGCCTGGTGCTCGGCGAGCGGGTCCGCGACCGCGGCGGCAAGTTCCGCATCCATATCCGCCAGCT
GGACTGGAATCGCTTCCACGAATTCCTGCCCATCGGCAGCGGCTACCAGCCGCTCTGTGCGCTGGTGCGC
TTCACCCTGCGCGATCCGCTGGATTACGACCTGCGCTTGGAGCTTCGCCCAGACGAGATCCGTGAACTAC
GCATCGGCGCCGCCAACAACTGCCGCCTCGGCTGGACCAGCTGGCTCGGGCGTGAACGCGCCGACGGCCT
GGTCACCCTGGGCAGCAAAACTCATTAA