SecReT6
Protein ID: 392419221
SecReT6 ID671
T6SS typei1
Gene symbol-
Locus tagA458_00670
StrainPseudomonas stutzeri CCUG 29243
Repliconchromosome [GenBank: NC_018028] [Browse all T6SS(s) in this replicon]
Location [Strand]134835..136625 [-]
Producthypothetical protein
NoteTssF
UniProt IDI4CMU5
KEGG IDpsc:A458_00670
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 8.20E-191, Aligned region: 3..596
Protein Sequence: 596 a.a.     [Download]
>gi|392419221|ref|YP_006455825.1| hypothetical protein A458_00670 [Pseudomonas stutzeri CCUG 29243]
MSFNHYYQSELTALRQLGKRFAERSPALAPFLGQAGRDPDVERLLEGFAFLTGRLRQKLDDELPELTHSL
MHLLWPNYMRPLPAFSMLQFDPLKRPGPALTVPRNTPVESNPVQGVSCCFRTAYATEVLPLALQALEYSV
KGTGALLSLRLQMSADGHLGEIGLNHLRLHLAGEPYISQLLYLSLLRHLGGIELVPLDAQGHPLTGPDGR
PLTPLQLNAKQVEPVGFAEDEALIPYPLNTFRGYRYLQEYFAFPDKFLFVDLKGLEIIQRIPEDLLKQAR
GLELRFDIHKAGVQRIRPTLDNVRLYCTPVVNLFPHDAIPIRLDGKQDQYLLLPAEYDSQQCGVFSVDRV
TGWKPGGMGYEEYVPFESFEHDASFDVPVARPHYSVRQQPSLLGEGQETWLSFGLRNLDQHETLSIELTC
TNQNLPRQLKLGDICKPSEDTPEFLSFRNISAVTPSYAPPLQRDYLWKLISNMSLNYLSLANVEALKVIL
ETYDLPRYYDKHAENVSRRRLGGLTHIAHQHVDRLHRGLPVRGVRTELTMNQDGFIGEGDLFLFASVLNE
FFALYASLNSYHELRVQSTQGEVYQWTPRMGQQPLL
 
Nucleotide Sequence: 1791 bp     [Download]
>gi|392419087|ref|NC_018028.1|:c136625-134835 Pseudomonas stutzeri CCUG 29243 chromosome, complete genome
ATGTCTTTCAACCACTACTACCAGAGCGAGCTCACCGCCCTGCGCCAGCTGGGCAAGCGCTTCGCTGAGC
GCAGTCCGGCACTGGCGCCATTCCTCGGGCAGGCCGGGCGCGATCCGGATGTCGAGCGGCTGCTCGAAGG
TTTCGCCTTTCTCACCGGGCGGCTGCGGCAGAAGCTCGATGACGAGCTGCCGGAGCTGACCCACTCGCTG
ATGCATCTGTTGTGGCCGAACTACATGCGCCCGCTGCCGGCCTTCAGCATGCTGCAGTTCGATCCGCTGA
AGCGACCCGGCCCGGCGCTGACGGTGCCGCGCAATACGCCGGTGGAATCCAATCCGGTGCAGGGCGTGAG
CTGCTGCTTTCGTACCGCCTACGCCACCGAGGTGCTGCCGCTGGCGTTGCAGGCGCTGGAGTATTCGGTC
AAGGGCACCGGGGCGCTGCTCAGCCTGCGCTTGCAGATGAGCGCCGATGGCCATCTCGGCGAGATCGGTC
TCAACCATCTGCGCCTGCACCTGGCAGGCGAGCCCTATATCAGCCAGCTGCTCTACCTGAGCCTGTTGCG
GCATCTGGGCGGCATCGAGCTGGTGCCGCTGGACGCGCAGGGTCATCCGCTGACCGGTCCGGATGGCCGA
CCGCTGACGCCCTTGCAGCTCAACGCCAAGCAGGTCGAACCGGTGGGATTCGCCGAGGATGAGGCGCTGA
TCCCCTACCCGCTCAATACATTCCGCGGCTATCGCTACCTGCAGGAATATTTCGCCTTCCCGGACAAGTT
TCTCTTCGTCGACCTTAAGGGCCTGGAGATCATTCAACGCATCCCCGAGGATTTGCTCAAGCAGGCCCGC
GGCCTGGAGCTGCGCTTCGACATTCACAAGGCCGGCGTACAGCGCATCCGCCCGACGCTGGACAACGTGC
GTCTGTACTGTACGCCGGTGGTCAACCTGTTCCCGCACGATGCCATCCCGATCCGCCTGGACGGCAAGCA
GGACCAGTACCTGCTGCTGCCAGCAGAGTATGACTCGCAGCAGTGCGGCGTGTTCTCGGTGGACCGGGTG
ACCGGCTGGAAACCCGGCGGCATGGGCTACGAAGAATACGTGCCGTTCGAATCCTTCGAGCACGACGCCA
GCTTCGATGTGCCGGTGGCGCGCCCGCACTACAGCGTGCGCCAGCAACCTTCGCTGCTCGGAGAAGGGCA
GGAAACCTGGCTCAGCTTCGGCCTGCGCAACCTCGACCAGCACGAGACGCTGTCCATCGAGCTGACCTGT
ACCAACCAGAACCTGCCGCGCCAGCTGAAGCTCGGCGACATCTGCAAGCCCAGCGAAGACACGCCGGAAT
TCCTCAGCTTCCGCAACATCTCGGCGGTCACCCCGAGCTACGCGCCGCCGCTGCAGCGTGACTATCTGTG
GAAGCTGATCAGCAACATGTCGCTGAACTACCTGTCGCTGGCCAACGTCGAGGCGCTCAAGGTGATCCTC
GAGACCTACGACCTGCCGCGCTATTACGACAAGCACGCCGAGAACGTCAGCCGGCGGCGCCTCGGCGGCC
TGACTCACATCGCCCACCAGCACGTCGATCGCCTGCATCGCGGGCTGCCGGTGCGCGGCGTACGCACCGA
ACTGACCATGAACCAGGACGGCTTCATCGGTGAGGGCGATCTGTTCCTCTTCGCCTCGGTGCTCAACGAA
TTCTTCGCCCTCTACGCCAGCCTCAACTCATATCACGAGCTGCGCGTGCAGAGCACACAGGGAGAGGTGT
ACCAATGGACGCCGCGCATGGGTCAGCAACCGCTGCTCTGA