SecReT6
Protein ID: 392419225
SecReT6 ID671
T6SS typei1
Gene symbol-
Locus tagA458_00690
StrainPseudomonas stutzeri CCUG 29243
Repliconchromosome [GenBank: NC_018028] [Browse all T6SS(s) in this replicon]
Location [Strand]139598..140005 [-]
ProductGPW/gp25 family protein
NoteTssE
UniProt IDI4CMU9
KEGG IDpsc:A458_00690
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.50E-19, Aligned region: 25..114
Protein Sequence: 135 a.a.     [Download]
>gi|392419225|ref|YP_006455829.1| GPW/gp25 family protein [Pseudomonas stutzeri CCUG 29243]
MNGYGSLFERLGGDAARRSGWSREVAAMASVAAHLAKMLSTRAGSVQTLPDYGLPDLNDMRLSLHDSLQQ
ARIAIERFIEAYEPRLTQVRVLSLPRTHDPLTLAFTIEGLLEVDGLKRQVSFSASLDGSGQVKVQ
 
Nucleotide Sequence: 408 bp     [Download]
>gi|392419087|ref|NC_018028.1|:c140005-139598 Pseudomonas stutzeri CCUG 29243 chromosome, complete genome
TTGAACGGATACGGCAGCCTCTTCGAACGCCTCGGCGGTGACGCCGCACGGCGCTCTGGCTGGAGCCGCG
AAGTCGCGGCGATGGCCTCGGTGGCTGCCCATCTGGCCAAGATGCTCAGCACCCGAGCGGGCAGCGTGCA
GACGCTGCCCGACTACGGGTTGCCCGATCTCAACGATATGCGCCTGTCGCTGCACGACTCGCTGCAGCAG
GCGCGTATCGCCATCGAACGTTTCATCGAAGCGTACGAACCCAGGTTGACCCAGGTGCGCGTGCTGTCGC
TGCCGCGCACCCACGATCCACTGACCCTCGCCTTCACCATCGAGGGCCTGCTGGAAGTGGATGGTCTCAA
GCGCCAGGTCAGCTTTTCCGCCAGCCTCGATGGCAGCGGGCAGGTCAAGGTCCAGTAA