SecReT6
Protein ID: 392419226
SecReT6 ID671
T6SS typei1
Gene symbol-
Locus tagA458_00695
StrainPseudomonas stutzeri CCUG 29243
Repliconchromosome [GenBank: NC_018028] [Browse all T6SS(s) in this replicon]
Location [Strand]140010..141488 [-]
Producthypothetical protein
NoteTssC
UniProt IDI4CMV0
KEGG IDpsc:A458_00695
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.60E-192, Aligned region: 65..490
Protein Sequence: 492 a.a.     [Download]
>gi|392419226|ref|YP_006455830.1| hypothetical protein A458_00695 [Pseudomonas stutzeri CCUG 29243]
MTTSAAAVEHGKHLAEGGILDRIIAETRLTPDDEAYDIAKRGVSAFIEELLKPQNENEPVKKAMVDRMIA
EIDAKLSQQMDEILHHPQFQALESSWRGLKLLVDRTNFRENIKLELLNASKQDLLDDFEDSPEIVQSGLY
KHIYTAEYGQFGGQPVGALIANYFFDPSAPDVKTMQYVASVASMSHAPFIAAAGPKFFGLESFTGLPDLK
DLKDHFEGPQFTKWQSFREQEDARYVGLTVPRFLLRNPYDPEDNPVKSFVYKENVAGSHEHYLWGNTAYT
FASRLTDSFAKFRWCPNIIGPQSGGAVEDLPLHHFESMGEIETKIPTEVLVSDRREYELAEEGFIALTMR
KGSDNAAFFSANSAQKPKFFGNSEEGKTAELNYKLGTQLPYLFIVNRLAHYLKVLQREQIGAWKERTDLE
LELNKWIRQFVADQENPSSEVRSRRPLRAAQVNVSDVEGEPGWYRVSLSVRPHFKYMGADFTLSLVGKLD
KE
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|392419087|ref|NC_018028.1|:c141488-140010 Pseudomonas stutzeri CCUG 29243 chromosome, complete genome
ATGACCACTAGCGCAGCCGCCGTCGAGCACGGCAAACACCTCGCCGAAGGCGGCATCCTCGACCGCATCA
TCGCCGAAACCCGCCTGACCCCCGACGACGAGGCCTACGACATCGCCAAGCGCGGTGTCTCGGCCTTCAT
CGAAGAACTGCTCAAGCCGCAGAACGAAAACGAGCCGGTGAAGAAGGCCATGGTCGACCGCATGATCGCG
GAGATCGACGCCAAGCTCAGCCAGCAGATGGACGAGATCCTGCACCACCCGCAGTTTCAGGCCCTGGAAT
CCTCCTGGCGCGGCCTCAAGCTGCTGGTGGATCGCACCAACTTCCGCGAGAACATCAAGCTCGAGCTGCT
CAACGCCTCCAAGCAGGACCTGCTCGACGACTTCGAGGACAGCCCGGAGATCGTTCAGTCCGGCCTGTAC
AAGCACATCTACACCGCCGAATACGGCCAGTTCGGTGGCCAACCGGTCGGTGCGCTGATCGCCAACTACT
TCTTCGACCCCAGCGCGCCTGACGTGAAGACCATGCAGTACGTCGCCAGTGTCGCGAGCATGTCCCACGC
GCCGTTCATCGCTGCTGCCGGCCCTAAATTCTTCGGCCTGGAGAGCTTCACCGGTCTGCCGGACCTGAAG
GACCTGAAGGATCACTTCGAGGGCCCGCAGTTCACCAAGTGGCAGAGCTTCCGCGAACAAGAAGATGCCC
GCTACGTCGGCCTGACCGTCCCGCGATTCCTGCTGCGCAACCCCTACGATCCAGAAGACAACCCGGTGAA
GAGCTTCGTCTACAAGGAAAACGTCGCCGGCAGCCACGAGCACTACCTGTGGGGCAACACGGCCTACACC
TTCGCCAGCCGCCTGACCGACAGCTTCGCCAAGTTCCGCTGGTGCCCTAACATCATCGGCCCGCAGAGCG
GGGGCGCAGTGGAAGACCTGCCGCTGCACCACTTCGAGAGCATGGGTGAGATCGAGACCAAGATCCCGAC
CGAAGTGCTGGTTTCCGACCGTCGTGAGTACGAGCTGGCCGAAGAGGGCTTTATCGCACTGACCATGCGC
AAAGGCAGCGACAACGCCGCGTTCTTCTCTGCCAATTCGGCGCAGAAGCCGAAGTTCTTCGGCAACAGCG
AGGAAGGCAAGACCGCCGAGCTGAACTACAAGCTCGGTACCCAGCTGCCCTACCTGTTCATCGTCAACCG
CCTGGCGCACTACCTGAAGGTGCTGCAGCGTGAGCAGATCGGTGCATGGAAGGAGCGCACCGACCTTGAG
CTGGAACTGAACAAGTGGATCCGCCAGTTCGTCGCCGACCAGGAGAATCCGAGCTCCGAAGTACGCAGCC
GTCGTCCGCTGCGCGCCGCCCAGGTCAACGTCAGCGACGTCGAGGGCGAACCGGGCTGGTACCGCGTCAG
CCTCAGCGTGCGTCCGCACTTCAAATACATGGGCGCGGATTTCACCCTGTCGCTGGTCGGCAAGCTGGAC
AAGGAATAA