SecReT6
Protein ID: 392419227
SecReT6 ID671
T6SS typei1
Gene symbol-
Locus tagA458_00700
StrainPseudomonas stutzeri CCUG 29243
Repliconchromosome [GenBank: NC_018028] [Browse all T6SS(s) in this replicon]
Location [Strand]141515..142021 [-]
Producthypothetical protein
NoteTssB
UniProt IDI4CMV1
KEGG IDpsc:A458_00700
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.40E-55, Aligned region: 5..159
Protein Sequence: 168 a.a.     [Download]
>gi|392419227|ref|YP_006455831.1| hypothetical protein A458_00700 [Pseudomonas stutzeri CCUG 29243]
MAKEGSVAPKERINVTFKPATGNAQEEVELPLKLMVLGDFTQRADDRKIEDRKPIAIDKNSFDEVLAKQE
LNLTFGVPNRLQDEQTDDELAVQLRINSMKDFNPANLVEQVPELKKLMELRDALVALKGPLGNAPAFRKA
IESVLADDDSRDRVLGELGLAAKEKLDA
 
Nucleotide Sequence: 507 bp     [Download]
>gi|392419087|ref|NC_018028.1|:c142021-141515 Pseudomonas stutzeri CCUG 29243 chromosome, complete genome
ATGGCCAAAGAAGGCTCGGTTGCACCCAAGGAACGCATCAACGTCACGTTCAAGCCAGCCACCGGCAATG
CTCAGGAAGAGGTCGAGCTGCCCCTCAAGCTGATGGTGCTGGGCGATTTCACCCAGCGCGCCGACGATCG
CAAGATCGAGGACCGCAAGCCCATCGCCATCGACAAGAACAGCTTCGACGAGGTCCTGGCCAAGCAGGAG
CTGAACCTGACCTTCGGCGTGCCGAACCGTCTGCAGGACGAGCAGACCGATGACGAGCTGGCCGTACAGC
TGCGCATCAACTCGATGAAGGACTTCAACCCGGCCAATCTGGTCGAGCAGGTCCCCGAATTGAAGAAACT
GATGGAACTGCGCGACGCCCTGGTCGCCCTGAAGGGCCCGCTTGGCAATGCCCCGGCTTTCCGCAAGGCC
ATCGAAAGCGTACTCGCCGACGACGATTCGCGTGACCGCGTACTCGGCGAGCTGGGCCTGGCGGCCAAAG
AGAAGCTGGACGCCTGA