SecReT6
Protein ID: 392979509
SecReT6 ID673
T6SS typei3
Gene symbol-
Locus tagA3UG_13335
StrainEnterobacter cloacae subsp. dissolvens SDM
Repliconchromosome [GenBank: NC_018079] [Browse all T6SS(s) in this replicon]
Location [Strand]2868747..2870669 [-]
Producthypothetical protein
NoteTssI
UniProt IDI6RL99
KEGG IDenl:A3UG_13335
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.60E-78, Aligned region: 22..327
Phage_base_V [PF04717], Evalue: 9.30E-26, Aligned region: 364..457
Protein Sequence: 640 a.a.     [Download]
>gi|392979509|ref|YP_006478097.1| hypothetical protein A3UG_13335 [Enterobacter cloacae subsp. dissolvens SDM]
MLNRITVQPPVEGLLFWKLSGREAMSESFALTLTLLGTDARIDRSKLLGQPVTVTIPTQNLLTPRYINGK
VTRVAVSAVELTGTRYAVYQLTVEPDLWPMKRDRNLRIFQGQTVPQIVKTLLGEHQVNVEDKLTGSYRVW
DYCVQYQESSLDFISRLMELEGIAYYFSHEADKHTLVLTDAATQHQPFSGYEVIPYHQTPSGGSTDEEGI
SQWALEDSVTPGIYSLDDYDFRKPNAWLFQAQQNPASPKPGSIDVYDWPGRFVETGHAEFYARIRQERWQ
VEHQQIQATATAAGIAPGHTFTLTNAPFFSDNGDYLVTAAGYHLEENRYASGEGETIHRIDFTVIPASVS
FRPAQSTAWPRTYGPQTAKVVGPQGESIWTDKYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGYGGV
QIPRVGDEVVVDFINGDPDRPIITGRVYNDASMPPWALPAAATQMGFMSRTKDGSVDNANALRFEDKAGA
EQVWIQAERNMDTSIKNDETHSVGGERSHYVKKNELHRVEANQIQAVKGGTEILTGKGKLDAAVEQYVLA
SGTKLRLVSGESAIELNANGKISLIGKEFNFYVEGDGHITTGGKLHLNTSGAKPGTTAPGAGHKGDIDAA
VQAKFTTKGD
 
Nucleotide Sequence: 1923 bp     [Download]
>gi|392976867|ref|NC_018079.1|:c2870669-2868747 Enterobacter cloacae subsp. dissolvens SDM chromosome, complete genome
ATGCTCAACCGAATTACCGTTCAGCCCCCCGTCGAGGGGCTGCTCTTCTGGAAACTCTCCGGCCGCGAGG
CGATGTCCGAGTCGTTCGCCCTGACGCTGACCCTGCTCGGCACGGATGCGCGTATCGACCGCAGCAAACT
GCTGGGCCAGCCGGTCACGGTGACCATCCCGACGCAGAACCTGCTTACCCCGCGCTACATCAACGGCAAA
GTCACCCGCGTGGCGGTGAGCGCCGTTGAGCTGACGGGCACGCGCTATGCGGTGTATCAGCTGACGGTGG
AGCCGGACCTGTGGCCGATGAAGCGCGACCGTAACCTGCGTATCTTCCAGGGCCAGACGGTGCCGCAGAT
AGTGAAAACCCTGCTGGGCGAGCATCAGGTCAACGTGGAAGATAAGCTTACCGGCAGCTACCGGGTATGG
GACTACTGTGTCCAGTATCAGGAGTCGAGCCTGGACTTCATCAGCCGCCTGATGGAGCTGGAGGGAATCG
CGTATTACTTCAGCCACGAGGCCGACAAACACACCCTGGTGCTCACCGATGCCGCGACGCAGCATCAGCC
CTTCAGCGGCTACGAGGTCATCCCCTATCACCAGACGCCGTCCGGCGGCAGCACGGACGAAGAGGGCATC
AGCCAGTGGGCGCTGGAGGACAGCGTCACGCCGGGCATTTACAGCCTCGACGACTACGACTTCCGCAAGC
CGAACGCGTGGCTGTTCCAGGCGCAGCAGAACCCGGCGTCACCGAAACCGGGTAGCATCGACGTGTACGA
CTGGCCTGGGCGCTTTGTGGAGACCGGGCATGCGGAGTTCTACGCCCGCATTCGCCAGGAGCGCTGGCAG
GTGGAACATCAGCAGATTCAGGCCACCGCCACGGCAGCGGGTATTGCGCCGGGTCACACCTTCACCCTGA
CCAACGCACCGTTCTTCAGCGATAACGGTGACTATCTGGTGACGGCGGCCGGGTATCATCTGGAAGAGAA
CCGCTATGCCAGCGGCGAAGGTGAAACCATCCACCGCATCGATTTCACGGTTATCCCGGCGTCGGTGTCG
TTCCGTCCGGCGCAGAGCACGGCATGGCCGCGCACCTACGGCCCGCAGACGGCGAAGGTTGTCGGGCCGC
AGGGAGAGAGCATCTGGACGGACAAATATGGCCGCGTGAAGGTGAAATTCCACTGGGACCGTCTGGCAAA
AGGGGACGACACCAGCTCCTGCTGGGTGCGTGTGTCGAGCGCATGGGCGGGCCAGGGCTACGGCGGGGTG
CAGATCCCGCGCGTGGGCGATGAGGTGGTGGTGGACTTTATCAACGGTGACCCGGACCGTCCGATTATTA
CCGGGCGCGTGTACAACGATGCCAGCATGCCACCGTGGGCGCTGCCGGCAGCGGCGACGCAGATGGGCTT
TATGAGCCGCACGAAAGACGGTTCCGTGGATAACGCCAACGCCCTGCGGTTTGAGGACAAGGCGGGTGCG
GAGCAGGTGTGGATCCAGGCCGAGCGAAATATGGATACCAGCATCAAGAATGACGAAACGCACAGCGTCG
GCGGCGAGCGTAGCCATTACGTAAAGAAAAACGAACTGCATCGCGTGGAAGCGAATCAGATCCAGGCGGT
AAAAGGCGGAACCGAGATCCTGACCGGCAAAGGAAAACTGGATGCGGCGGTGGAGCAGTATGTCCTTGCC
TCCGGCACCAAACTGCGGCTGGTGTCTGGTGAAAGTGCGATTGAACTTAACGCTAACGGCAAAATTAGCC
TGATCGGTAAAGAGTTTAACTTCTACGTTGAAGGGGATGGTCATATCACCACGGGCGGTAAGCTGCATCT
CAATACGTCAGGCGCTAAACCAGGCACAACGGCGCCGGGCGCGGGGCACAAAGGAGACATTGATGCGGCG
GTTCAGGCGAAATTCACTACCAAGGGTGATTAA