SecReT6
Protein ID: 392979511
SecReT6 ID673
T6SS typei3
Gene symbol-
Locus tagA3UG_13345
StrainEnterobacter cloacae subsp. dissolvens SDM
Repliconchromosome [GenBank: NC_018079] [Browse all T6SS(s) in this replicon]
Location [Strand]2871259..2873187 [-]
Producthypothetical protein
NoteTssI
UniProt IDI6RAG9
KEGG IDenl:A3UG_13345
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.00E-77, Aligned region: 22..327
Phage_base_V [PF04717], Evalue: 9.90E-26, Aligned region: 364..457
Protein Sequence: 642 a.a.     [Download]
>gi|392979511|ref|YP_006478099.1| hypothetical protein A3UG_13345 [Enterobacter cloacae subsp. dissolvens SDM]
MLNRITVQLPVEGLLFWKLSGREAMSESFALTLTLLGTDARIDRSKLLGQPVTVTIPTQNLLTPRYINGK
VTRVAVSAVELTGTRYAVYQLSVEPDLWPMKRDRNLRIFQGQTVPQIVKTLLGEHQVNVEDKLTGSYRVW
DYCVQYQESSLDFISRLMELEGIAYYFSHEADKHTLVLTDAATQHQPFSGYEVIPYHQTPSGGSTDEEGI
SQWALEDSVTPGIYSLDDYDFRKPNAWLFQAQQNPASPKPGSIDVYDWPGRFVETGHAEFYARIRQERWQ
VEHQQIQATATAAGIAPGHTFTLTNAPFFSDNGDYLVTAAGYHLEENRYASGEGETIHRIDFTVIPASVS
FRPAQSTAWPRTYGPQTAKVVGPQGESIWTDKYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGYGGV
QIPRVGDEVVVDFINGDPDRPIITGRVYNDASMPPWALPAAATQMGFMSRTKDGSVDNANALRFEDKAGA
EQVWLQAERNLDINVKNDESHATEKNRTLFVGEDETLRVAKNQKAGVKGDVVCLTGNSRSDKVVNNFIIS
AGNTLRLECGESAIELSKDGSVNIIGNNFNFTAKQSAQINTLSGELHLNPADGSNAIDAPGASHQTAIQQ
EVDGFFVFNANK
 
Nucleotide Sequence: 1929 bp     [Download]
>gi|392976867|ref|NC_018079.1|:c2873187-2871259 Enterobacter cloacae subsp. dissolvens SDM chromosome, complete genome
ATGCTCAACCGAATTACCGTCCAGCTCCCGGTCGAGGGGCTGCTCTTCTGGAAACTCTCCGGCCGCGAGG
CGATGTCTGAGTCGTTCGCCCTGACGCTGACCCTGCTCGGTACGGATGCGCGTATCGACCGCAGCAAACT
GCTGGGCCAGCCGGTCACGGTGACCATCCCGACGCAGAATCTGCTTACCCCGCGCTACATCAACGGCAAA
GTCACGCGCGTGGCGGTGAGCGCCGTTGAGCTGACGGGGACGCGCTATGCGGTGTACCAGCTTTCTGTAG
AGCCGGACCTGTGGCCGATGAAGCGTGACCGTAACCTGCGTATCTTCCAGGGCCAGACGGTGCCGCAGAT
TGTGAAAACCCTGCTGGGCGAGCATCAGGTCAACGTGGAAGATAAGCTTACCGGCAGCTACCGGGTATGG
GACTACTGTGTCCAGTATCAGGAGTCGAGCCTGGACTTTATCAGCCGCCTGATGGAGCTGGAGGGAATCG
CGTATTACTTCAGCCACGAGGCCGACAAACACACCCTGGTGCTCACCGATGCCGCGACGCAGCATCAGCC
CTTCAGCGGCTACGAGGTCATCCCCTATCACCAGACGCCGTCCGGCGGCAGCACGGACGAAGAGGGCATC
AGCCAGTGGGCGCTGGAGGACAGCGTCACGCCGGGCATTTACAGCCTCGACGACTACGACTTCCGCAAGC
CGAACGCGTGGCTGTTCCAGGCGCAGCAGAACCCGGCCTCGCCGAAGCCGGGCAGCATCGACGTGTACGA
CTGGCCTGGGCGCTTTGTGGAGACCGGGCATGCGGAGTTCTACGCCCGCATTCGCCAGGAGCGCTGGCAG
GTGGAACATCAGCAGATTCAGGCCACGGCCACGGCTGCGGGTATTGCGCCGGGCCACACCTTCACCCTGA
CCAACGCACCGTTCTTCAGCGATAACGGTGACTATCTGGTGACGGCGGCCGGATATCATCTGGAAGAGAA
CCGCTACGCGAGCGGCGAAGGGGAGACCATTCACCGCATCGATTTCACGGTTATCCCGGCGTCGGTGTCG
TTCCGTCCGGCGCAGAGCACGGCGTGGCCGCGAACCTACGGCCCGCAGACGGCGAAGGTTGTCGGGCCAC
AGGGGGAGAGCATCTGGACGGACAAATATGGCCGCGTGAAGGTGAAATTCCACTGGGACCGTCTGGCAAA
AGGGGACGACACCAGCTCCTGCTGGGTGCGTGTGTCGAGCGCCTGGGCGGGCCAGGGCTACGGCGGGGTG
CAGATCCCGCGCGTGGGCGATGAGGTGGTGGTGGACTTTATCAACGGTGACCCGGACCGTCCGATTATTA
CCGGGCGCGTGTACAACGACGCCAGCATGCCACCGTGGGCGCTGCCGGCAGCGGCGACGCAGATGGGCTT
TATGAGCCGCACGAAAGATGGCTCCGTGGATAACGCCAACGCCCTGCGGTTTGAGGACAAGGCGGGGGCA
GAACAGGTGTGGCTCCAGGCCGAGCGCAATCTCGATATCAACGTCAAAAATGATGAATCGCATGCCACGG
AAAAAAATCGAACCCTATTTGTGGGAGAGGATGAAACCTTACGGGTGGCAAAAAATCAGAAAGCAGGGGT
TAAAGGGGATGTGGTCTGCCTGACGGGCAACAGTCGCAGCGATAAAGTTGTTAACAACTTTATTATTTCA
GCGGGCAATACGTTGAGGCTGGAGTGTGGTGAAAGCGCCATTGAATTATCAAAAGACGGGAGCGTGAATA
TCATTGGCAATAACTTTAACTTTACCGCAAAACAAAGTGCACAAATCAACACGCTTTCCGGGGAACTGCA
TCTTAACCCAGCTGATGGCAGCAATGCCATTGATGCGCCAGGGGCATCTCACCAGACGGCAATTCAGCAG
GAAGTGGATGGTTTTTTTGTTTTCAATGCCAATAAGTAA