SecReT6
Protein ID: 392979519
SecReT6 ID673
T6SS typei3
Gene symbol-
Locus tagA3UG_13395
StrainEnterobacter cloacae subsp. dissolvens SDM
Repliconchromosome [GenBank: NC_018079] [Browse all T6SS(s) in this replicon]
Location [Strand]2880138..2882753 [-]
Producttype VI secretion system protein VasG
NoteTssH
UniProt IDI6RLA7
KEGG IDenl:A3UG_13395
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.10E-41, Aligned region: 224..241
AAA_2 [PF07724], Evalue: 4.10E-41, Aligned region: 602..767
AAA [PF00004], Evalue: 2.40E-21, Aligned region: 134..157
AAA [PF00004], Evalue: 2.40E-21, Aligned region: 223..355
AAA [PF00004], Evalue: 2.40E-21, Aligned region: 608..692
AAA [PF00004], Evalue: 2.40E-21, Aligned region: 803..852
ClpB_D2-small [PF10431], Evalue: 5.20E-16, Aligned region: 775..847
AAA_5 [PF07728], Evalue: 3.50E-13, Aligned region: 223..301
AAA_5 [PF07728], Evalue: 3.50E-13, Aligned region: 607..726
AAA_16 [PF13191], Evalue: 1.70E-11, Aligned region: 33..82
AAA_16 [PF13191], Evalue: 1.70E-11, Aligned region: 200..243
AAA_16 [PF13191], Evalue: 1.70E-11, Aligned region: 268..301
AAA_16 [PF13191], Evalue: 1.70E-11, Aligned region: 483..483
AAA_16 [PF13191], Evalue: 1.70E-11, Aligned region: 604..652
AAA_22 [PF13401], Evalue: 5.30E-08, Aligned region: 223..309
AAA_22 [PF13401], Evalue: 5.30E-08, Aligned region: 370..389
AAA_22 [PF13401], Evalue: 5.30E-08, Aligned region: 606..638
AAA_22 [PF13401], Evalue: 5.30E-08, Aligned region: 668..690
Sigma54_activat [PF00158], Evalue: 2.10E-07, Aligned region: 205..240
Sigma54_activat [PF00158], Evalue: 2.10E-07, Aligned region: 607..723
AAA_14 [PF13173], Evalue: 9.80E-07, Aligned region: 57..78
AAA_14 [PF13173], Evalue: 9.80E-07, Aligned region: 223..304
AAA_14 [PF13173], Evalue: 9.80E-07, Aligned region: 329..389
AAA_14 [PF13173], Evalue: 9.80E-07, Aligned region: 606..717
AAA_18 [PF13238], Evalue: 9.60E-06, Aligned region: 223..243
AAA_18 [PF13238], Evalue: 9.60E-06, Aligned region: 609..636
AAA_18 [PF13238], Evalue: 9.60E-06, Aligned region: 796..856
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 222..245
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 605..629
AAA_25 [PF13481], Evalue: 1.70E-05, Aligned region: 222..247
AAA_25 [PF13481], Evalue: 1.70E-05, Aligned region: 276..320
AAA_25 [PF13481], Evalue: 1.70E-05, Aligned region: 498..520
AAA_25 [PF13481], Evalue: 1.70E-05, Aligned region: 604..632
AAA_17 [PF13207], Evalue: 2.00E-05, Aligned region: 223..288
AAA_17 [PF13207], Evalue: 2.00E-05, Aligned region: 607..643
IstB_IS21 [PF01695], Evalue: 2.10E-05, Aligned region: 209..242
IstB_IS21 [PF01695], Evalue: 2.10E-05, Aligned region: 607..635
IstB_IS21 [PF01695], Evalue: 2.10E-05, Aligned region: 718..740
Zeta_toxin [PF06414], Evalue: 4.00E-05, Aligned region: 222..243
Zeta_toxin [PF06414], Evalue: 4.00E-05, Aligned region: 600..657
Zeta_toxin [PF06414], Evalue: 4.00E-05, Aligned region: 781..816
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 201..237
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 276..306
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 606..646
NACHT [PF05729], Evalue: 0.00015, Aligned region: 223..250
NACHT [PF05729], Evalue: 0.00015, Aligned region: 280..323
NACHT [PF05729], Evalue: 0.00015, Aligned region: 608..639
Clp_N [PF02861], Evalue: 0.00016, Aligned region: 28..75
Clp_N [PF02861], Evalue: 0.00016, Aligned region: 116..123
Clp_N [PF02861], Evalue: 0.00016, Aligned region: 310..320
AAA_29 [PF13555], Evalue: 0.00088, Aligned region: 215..238
AAA_29 [PF13555], Evalue: 0.00088, Aligned region: 605..632
RNA_helicase [PF00910], Evalue: 0.0021, Aligned region: 224..244
RNA_helicase [PF00910], Evalue: 0.0021, Aligned region: 608..629
RNA_helicase [PF00910], Evalue: 0.0021, Aligned region: 705..726
SRP54 [PF00448], Evalue: 0.0042, Aligned region: 222..243
SRP54 [PF00448], Evalue: 0.0042, Aligned region: 606..643
Protein Sequence: 871 a.a.     [Download]
>gi|392979519|ref|YP_006478107.1| type VI secretion system protein VasG [Enterobacter cloacae subsp. dissolvens SDM]
MSEISRAVLFGKLDTLLFTSLESATAFCKLRGNPYVELVHWLHQLMQQQDGDLQQVIRHFALDEQQLTRD
IVAALDALPRGASSVSDLSEHIDSAVERAWVYGSLKFGVSRIRGGHLLIGILKTWNLANVLKSISAQFTR
LNVEVLIEQFDTICANSKETQQAAAAVDAPAGSVPAAQGTLAQYGQDLTARAREGKIDPVVGRDEEIRQM
VDILMRRRQNNPLLTGEAGVGKTAVVEGLALRIADGDVPEPLQNIQLWLLDIGMLQAGAGMKGEFEARLQ
ALINEVQSSATPIILFIDEIHTLIGAGGQQGTGDAANLLKPALARGQLRTIGATTWAEYKKYIEKDPALT
RRFQTVQVHEPDEAKAVLMLRSTVSPLETHHQVLLLDEAVSAAVKLSHRYIPARQLPDKAVALLDTACAR
VAVSQSAPPAQLEDCLRHLAALDVEIEIAEREARVGAGESERVTALTAERDAYEAKREALARRWEDERSL
VQEIIRLRAALFAAGDDDTAALRSQLAEQQQALNALQGDEPLLFAAVDENVVAAVVSDWTGIPLGRMVKN
EIDAVLNLADTLNQRVIGQRHGLDLIARRVKTSRAKLDDPNKPVGVFMLCGPSGVGKTETALALAESLYG
GEQNVITINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEKAHPDVHEIFFQVF
DKGWMEDGEGRHIDFRNTIIILTSNVGTELISAMCADPELMPEPEALSGALRQPLLEVFPPALLGRLLVV
PYYPLSDAMLGQIVRLQLKRIQRRLEENHNIISEFDDSVVEQIVQRCTEVESGGRMVDAILTNTLLPQMS
QILLTASRSDEQYRRLHVTCEQGEFHCQFAA
 
Nucleotide Sequence: 2616 bp     [Download]
>gi|392976867|ref|NC_018079.1|:c2882753-2880138 Enterobacter cloacae subsp. dissolvens SDM chromosome, complete genome
ATGTCAGAAATTAGCCGTGCCGTGCTTTTCGGCAAACTGGATACGCTGTTATTTACCTCTCTGGAAAGCG
CCACCGCGTTCTGCAAGCTGCGCGGCAACCCCTACGTCGAGCTGGTGCACTGGCTGCATCAGTTGATGCA
GCAGCAGGATGGCGATCTGCAACAGGTGATCCGTCATTTTGCCCTCGACGAACAGCAACTGACGCGCGAT
ATCGTGGCGGCGCTCGATGCCCTGCCGCGCGGAGCCAGTTCCGTTTCCGATCTCTCCGAACATATCGACA
GCGCCGTCGAGCGCGCCTGGGTCTATGGATCGCTGAAGTTTGGCGTCAGCCGTATCCGCGGCGGCCATCT
GCTGATCGGCATTCTGAAAACCTGGAATCTGGCTAACGTGCTGAAGAGCATCTCGGCGCAGTTTACCCGT
CTTAACGTCGAGGTGCTGATTGAGCAGTTCGATACCATCTGCGCCAACAGCAAAGAGACGCAGCAGGCCG
CTGCCGCAGTGGATGCGCCAGCCGGTTCGGTGCCTGCTGCCCAGGGCACGCTGGCCCAGTATGGTCAGGA
CCTGACCGCCCGTGCCCGTGAAGGCAAAATTGACCCGGTGGTCGGGCGCGATGAAGAGATCCGCCAGATG
GTCGATATCCTGATGCGTCGCCGACAGAACAACCCGCTGCTGACCGGGGAAGCCGGCGTCGGAAAAACGG
CGGTGGTGGAAGGGCTGGCGCTGCGCATCGCCGACGGCGATGTGCCGGAGCCGCTGCAAAACATACAGCT
GTGGCTGCTGGATATCGGCATGCTGCAGGCCGGTGCCGGGATGAAAGGCGAGTTTGAAGCCCGTCTGCAG
GCATTAATCAATGAAGTACAGTCCAGCGCCACGCCAATCATTCTGTTTATCGATGAGATCCACACCCTGA
TCGGTGCGGGCGGTCAGCAGGGCACCGGCGACGCCGCTAACCTGCTGAAGCCGGCGCTGGCGCGTGGACA
ACTGCGTACCATTGGCGCCACCACCTGGGCGGAATACAAAAAATACATCGAGAAAGATCCGGCGTTGACC
CGTCGCTTCCAGACGGTGCAGGTACATGAACCCGATGAGGCCAAAGCGGTTCTGATGCTGCGCAGCACCG
TGTCGCCGCTGGAGACCCATCATCAGGTCTTACTGCTCGACGAAGCGGTTAGCGCAGCCGTGAAGCTTTC
GCATCGCTACATTCCCGCCCGTCAACTGCCGGATAAAGCCGTTGCGCTGCTGGATACGGCCTGCGCCCGC
GTGGCGGTGAGCCAGAGTGCACCTCCGGCGCAGCTGGAAGATTGCCTGCGCCATCTTGCGGCGCTGGACG
TAGAAATTGAGATAGCGGAGCGCGAAGCGCGCGTCGGTGCAGGGGAATCTGAGCGCGTTACAGCACTGAC
CGCAGAGCGTGACGCGTATGAAGCCAAACGTGAGGCCCTGGCCCGGCGCTGGGAAGACGAGCGCAGCCTG
GTGCAGGAGATCATCCGCCTGCGTGCCGCACTGTTTGCGGCGGGCGATGACGATACCGCAGCGCTGCGCA
GCCAACTGGCAGAGCAGCAGCAGGCGCTGAACGCCTTACAGGGGGATGAACCGCTGCTGTTTGCCGCTGT
GGATGAAAACGTGGTGGCGGCAGTAGTCTCTGACTGGACCGGCATCCCGCTGGGCCGGATGGTGAAAAAC
GAGATTGACGCGGTACTGAACCTCGCCGACACGCTGAACCAGCGGGTGATTGGTCAGCGTCACGGTCTGG
ATCTGATTGCCCGCCGGGTGAAAACCTCCCGGGCGAAACTCGACGATCCGAACAAGCCGGTCGGCGTGTT
TATGCTCTGCGGTCCGTCGGGGGTGGGGAAAACCGAAACCGCGCTGGCGCTGGCGGAGTCGCTGTACGGT
GGCGAACAGAACGTCATCACCATTAATATGAGTGAATTCCAGGAAGCGCATACGGTTTCAACCTTAAAAG
GTGCACCGCCGGGATACGTCGGTTATGGTGAAGGCGGGGTGTTAACCGAGGCCGTCCGTCGCCGTCCTTA
CAGCGTGGTGCTGCTGGACGAAATCGAAAAAGCCCACCCGGACGTACATGAGATCTTCTTCCAGGTCTTT
GACAAAGGCTGGATGGAGGACGGCGAAGGCCGTCACATTGATTTCCGTAATACGATTATTATTCTGACGT
CTAACGTCGGGACCGAGCTTATCAGCGCCATGTGTGCCGATCCGGAACTGATGCCGGAGCCGGAGGCGTT
AAGCGGGGCGCTGCGCCAGCCGCTGCTGGAGGTGTTCCCACCGGCGCTGCTGGGCCGGTTGCTGGTGGTG
CCGTACTATCCGCTGAGCGACGCGATGCTGGGGCAGATTGTTCGCCTGCAGCTCAAACGCATTCAGCGTC
GCCTGGAAGAGAATCACAATATTATTTCCGAGTTTGATGACAGCGTTGTAGAACAGATTGTTCAGCGCTG
TACCGAGGTGGAATCAGGTGGACGTATGGTGGATGCGATCCTGACCAACACCTTGCTGCCTCAGATGAGT
CAGATATTACTTACCGCCAGCCGCAGCGACGAGCAGTACCGACGTCTGCATGTCACCTGCGAGCAGGGCG
AGTTTCACTGTCAGTTTGCCGCGTAA