SecReT6
Protein ID: 392979520
SecReT6 ID673
T6SS typei3
Gene symbol-
Locus tagA3UG_13400
StrainEnterobacter cloacae subsp. dissolvens SDM
Repliconchromosome [GenBank: NC_018079] [Browse all T6SS(s) in this replicon]
Location [Strand]2882792..2883835 [-]
Producttype VI secretion system protein ImpH
NoteTssG
UniProt IDI6SJX8
KEGG IDenl:A3UG_13400
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.80E-107, Aligned region: 27..330
Protein Sequence: 347 a.a.     [Download]
>gi|392979520|ref|YP_006478108.1| type VI secretion system protein ImpH [Enterobacter cloacae subsp. dissolvens SDM]
MSDVVTVPLKVHRLTPLPDSFWRGVRETPWRYDLFQLLRRIDAQGGERYPLGRAPLPKFEPLRLGQQPSM
SFAPSTVAQVRQREGNGLHEVSILSFGLFGPNGPLPVHMTEYARERIHHHQDTSLSAFADLFHHRLTLLF
YRAWADAQPAVSLDRADNKRFEGYLASLIGMGQPGQMDKGSLSAHARFTHAGHLTRHGRDPEGLEKILRN
YFKAPVKLIANVPQWMPLSPREQAQLGAGRRVPRMGESAFLGVAVRDVQHKFRIEIGPLSAEAYNRFLPG
EAWVTELRDWVRQYAGVEFEWETRVILRADAVQGATLGSTGRLGYNTWLGLQPQPVPRGDLVYRAER
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|392976867|ref|NC_018079.1|:c2883835-2882792 Enterobacter cloacae subsp. dissolvens SDM chromosome, complete genome
ATGAGCGACGTTGTCACCGTGCCACTGAAGGTCCATCGTCTGACGCCGCTGCCGGACAGTTTCTGGCGCG
GGGTTCGCGAGACGCCATGGCGCTACGATCTGTTCCAGCTGTTAAGGCGCATTGATGCTCAGGGCGGGGA
ACGCTACCCGCTGGGGCGTGCGCCGCTGCCAAAATTCGAGCCGCTACGCCTGGGCCAGCAGCCGTCGATG
AGTTTTGCGCCGTCGACGGTGGCGCAGGTACGCCAGCGTGAAGGCAACGGGCTGCACGAGGTCTCCATTC
TGAGCTTCGGCCTGTTTGGTCCTAACGGGCCGCTGCCGGTTCACATGACCGAGTACGCCCGCGAGCGGAT
CCATCATCATCAGGACACCAGCCTGAGCGCGTTTGCCGATCTGTTCCATCATCGTCTGACGCTGCTGTTT
TATCGCGCCTGGGCCGATGCGCAGCCTGCCGTCTCCCTCGACCGCGCCGACAATAAACGTTTTGAGGGAT
ATCTGGCGTCGTTGATTGGGATGGGACAGCCCGGCCAGATGGACAAAGGCAGCCTGAGCGCCCACGCCCG
CTTTACCCACGCCGGACACCTGACCCGCCACGGACGGGATCCTGAGGGTCTGGAAAAAATCCTGCGTAAC
TATTTTAAAGCCCCGGTCAAACTGATCGCCAACGTACCGCAGTGGATGCCGCTTTCACCGCGCGAGCAGG
CGCAGCTGGGAGCGGGGCGCCGCGTGCCGCGGATGGGTGAATCTGCGTTTCTGGGCGTGGCGGTCCGCGA
CGTGCAGCATAAATTTCGTATCGAGATTGGCCCGCTCAGCGCGGAAGCGTACAACCGGTTTTTGCCCGGT
GAAGCATGGGTAACCGAACTGCGGGACTGGGTACGCCAGTACGCAGGGGTGGAATTTGAATGGGAAACAC
GGGTGATCCTGCGCGCTGACGCCGTGCAGGGCGCCACGCTCGGCAGCACCGGGCGATTGGGGTACAACAC
CTGGCTGGGCCTTCAGCCGCAGCCTGTCCCGCGTGGCGATCTGGTGTATCGCGCAGAGCGGTAA