SecReT6
Protein ID: 392979521
SecReT6 ID673
T6SS typei3
Gene symbol-
Locus tagA3UG_13405
StrainEnterobacter cloacae subsp. dissolvens SDM
Repliconchromosome [GenBank: NC_018079] [Browse all T6SS(s) in this replicon]
Location [Strand]2883832..2885703 [-]
Producttype VI secretion system protein ImpG
NoteTssF
UniProt IDI6RAH5
KEGG IDenl:A3UG_13405
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.30E-209, Aligned region: 5..623
Protein Sequence: 623 a.a.     [Download]
>gi|392979521|ref|YP_006478109.1| type VI secretion system protein ImpG [Enterobacter cloacae subsp. dissolvens SDM]
MESKLLEYYNRELAYLREMGAEFAERYPKVAGRLGMRGIEVADPYTERLMEGFAFLTSRVQMKMDAEFPR
FSQRLLEMIAPNYLAPTPSMAIAEIQPDSSRGDLSNGFIVPRGTMMDSLALKKTGVTCSYTTAHEVNLLP
LKIDKVELGGVPADLPLTQLGLGQQGISSALRIRIACDGPQNLGHLDFDRLEFFLSGPDIEALKLLELVM
EHHVGVVCQTVSKHPQRDVLASDALRQEGFDADQSLLPDDLRNFDGYRLLQEYFAFPARFRFISLSGLSK
LIQRCENEKSFDIFILLDKTDEQLERVVDASHLALHCTPVINLFPKVAARQKLSEGQHEYHLVVDNIRPL
DYEIYAVNKIYGSADGQRDDQTFRPFWSTWSGDAGNYGAYFSLRREQRVLSEHALRYGTRTGYIGSEVFV
SLVDEQHAPWQENLRYISAEVLCTSRDLPLMLQQELGQFIMADSMPVKSLTLRKGPTPPRPALAEGFSTW
RLISQLQMNYLSLMDSENEDGAAALRQLLGLYANLAETPVARQVEGVRHCVLEPVHRRVPEPGPVVFARG
IGITLTVDERAFSGASPWLFGSVLERLFARLVSINSFTEFTLKSQQRGEIGYWAPRMGKRALV
 
Nucleotide Sequence: 1872 bp     [Download]
>gi|392976867|ref|NC_018079.1|:c2885703-2883832 Enterobacter cloacae subsp. dissolvens SDM chromosome, complete genome
GTGGAAAGTAAACTGCTCGAATATTACAACCGTGAGTTGGCCTATCTGCGTGAGATGGGCGCCGAATTTG
CCGAGCGCTATCCCAAAGTGGCCGGACGGCTGGGCATGCGCGGCATCGAAGTGGCGGATCCGTACACCGA
ACGTCTGATGGAGGGCTTTGCCTTTCTGACCTCGCGCGTGCAGATGAAAATGGACGCGGAGTTTCCGCGC
TTCTCCCAGCGCTTGCTGGAGATGATTGCGCCAAACTATCTCGCGCCCACTCCGTCCATGGCGATTGCTG
AAATTCAGCCTGACAGCAGCCGTGGCGATTTGAGCAACGGTTTTATCGTGCCGCGCGGCACAATGATGGA
CAGCCTGGCGCTGAAGAAAACCGGCGTGACCTGCAGCTACACCACGGCGCATGAGGTGAACCTGCTGCCG
CTGAAAATCGACAAGGTTGAGCTGGGCGGTGTACCTGCCGACCTGCCCCTGACGCAGCTGGGTCTGGGCC
AGCAGGGGATCAGCAGCGCCTTACGGATCCGCATTGCCTGCGACGGTCCGCAAAACCTCGGCCACCTTGA
TTTTGACCGCCTGGAGTTTTTCCTCAGCGGCCCGGATATCGAGGCGTTAAAGCTGCTGGAGCTGGTGATG
GAGCACCATGTCGGGGTGGTCTGCCAGACCGTCAGCAAACATCCGCAGCGTGATGTGCTGGCGTCTGATG
CCCTGCGTCAGGAAGGGTTTGATGCGGATCAGTCGCTACTCCCGGACGACCTGCGCAACTTTGACGGCTA
CCGTCTCCTGCAGGAGTACTTTGCTTTTCCGGCCCGTTTCCGCTTCATCAGCCTGAGCGGGCTGAGCAAA
CTGATCCAGCGCTGCGAAAACGAAAAATCCTTCGATATCTTTATTCTGCTGGATAAAACCGATGAACAGC
TGGAGCGCGTTGTCGATGCCAGCCATCTGGCCCTGCACTGCACGCCGGTGATCAACCTGTTCCCGAAAGT
GGCGGCGCGTCAGAAGCTGAGCGAAGGCCAGCATGAATACCATCTGGTGGTGGATAACATCCGTCCGCTG
GATTACGAAATTTACGCGGTGAACAAGATATACGGCAGCGCGGATGGTCAGCGCGACGACCAGACGTTTC
GTCCGTTCTGGAGCACCTGGAGCGGGGATGCGGGCAACTATGGTGCCTATTTCTCCCTGCGTCGGGAGCA
ACGCGTGCTTTCAGAACATGCCCTGCGTTACGGCACCCGCACCGGCTACATCGGCTCGGAGGTGTTTGTC
TCGCTGGTGGATGAGCAGCATGCGCCCTGGCAGGAGAACCTGCGCTATATCTCCGCCGAGGTGCTGTGCA
CCAGCCGGGATCTGCCGCTGATGCTGCAGCAGGAGCTGGGACAGTTCATTATGGCCGACTCCATGCCGGT
GAAGTCTCTGACCTTGCGCAAGGGGCCGACGCCGCCGCGTCCGGCGCTGGCAGAAGGGTTCAGCACCTGG
CGGTTGATCAGCCAGCTACAGATGAACTACCTCAGCCTGATGGACAGCGAAAACGAAGACGGTGCCGCCG
CGCTGCGTCAGCTGTTAGGGCTGTACGCCAATCTCGCGGAGACGCCGGTTGCGCGTCAGGTAGAAGGGGT
TCGTCACTGCGTGCTGGAGCCGGTTCACCGCCGCGTGCCCGAGCCGGGACCGGTGGTCTTCGCCCGCGGC
ATCGGCATTACCCTGACGGTGGATGAACGTGCGTTTTCCGGTGCCAGCCCCTGGCTTTTCGGTAGCGTGC
TGGAGCGGCTGTTTGCCCGGCTGGTGTCGATCAACAGCTTCACGGAGTTCACCCTGAAAAGTCAGCAGCG
CGGCGAGATCGGTTACTGGGCGCCGCGCATGGGTAAAAGGGCACTGGTATGA