SecReT6
Protein ID: 392979522
SecReT6 ID673
T6SS typei3
Gene symbol-
Locus tagA3UG_13410
StrainEnterobacter cloacae subsp. dissolvens SDM
Repliconchromosome [GenBank: NC_018079] [Browse all T6SS(s) in this replicon]
Location [Strand]2885706..2886269 [-]
Producttype VI secretion system protein ImpF
NoteTssE
UniProt IDI6SFM2
KEGG IDenl:A3UG_13410
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.40E-19, Aligned region: 56..166
Protein Sequence: 187 a.a.     [Download]
>gi|392979522|ref|YP_006478110.1| type VI secretion system protein ImpF [Enterobacter cloacae subsp. dissolvens SDM]
MSNPAGEGDLLRSGWQARSKQEKVGARDKMQPSLLDRLTDNDPEKKRESANSNLITHAALRRNVLRDLQW
LFNTINHDASGDLSLLPHVSRSVVNFGVAPLAGKRMSDIEWHDIQRKLTEAIVNFEPRILPQGLQVRCVS
DTSSLDLHNVLSIEIKGRLWCVPYPLEFLFRTDVDLENGHFELKDAG
 
Nucleotide Sequence: 564 bp     [Download]
>gi|392976867|ref|NC_018079.1|:c2886269-2885706 Enterobacter cloacae subsp. dissolvens SDM chromosome, complete genome
ATGAGTAATCCTGCTGGCGAAGGCGATCTGCTGCGCAGCGGCTGGCAGGCCCGCAGCAAGCAGGAGAAGG
TAGGGGCGCGCGACAAAATGCAGCCCTCGCTGCTCGATCGCCTCACCGACAACGACCCGGAGAAAAAACG
CGAGTCGGCCAACAGCAACCTGATCACCCATGCCGCGCTGCGTCGCAACGTGCTGCGGGATCTGCAGTGG
CTGTTTAACACCATCAATCACGACGCTTCCGGCGATTTGAGCCTGCTGCCGCACGTGAGCCGCTCGGTGG
TGAATTTTGGCGTTGCGCCGCTGGCCGGGAAGCGTATGTCGGACATCGAATGGCACGACATTCAGCGCAA
ACTCACCGAGGCGATTGTCAACTTTGAACCCCGCATTTTGCCCCAGGGGCTGCAGGTCCGCTGTGTGTCG
GACACCTCCTCGCTGGATCTGCACAACGTGCTCTCCATCGAGATAAAAGGGCGTTTGTGGTGTGTGCCGT
ACCCGCTGGAGTTTCTGTTTCGCACCGATGTCGATCTGGAAAACGGCCACTTTGAACTGAAAGATGCGGG
GTGA