SecReT6
Protein ID: 392979523
SecReT6 ID673
T6SS typei3
Gene symbol-
Locus tagA3UG_13415
StrainEnterobacter cloacae subsp. dissolvens SDM
Repliconchromosome [GenBank: NC_018079] [Browse all T6SS(s) in this replicon]
Location [Strand]2886262..2887074 [-]
Producttype VI secretion system protein ImpE
NoteTagJ
UniProt IDI6S6N2
KEGG IDenl:A3UG_13415
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 2.20E-42, Aligned region: 140..263
TPR_19 [PF14559], Evalue: 0.0028, Aligned region: 12..68
TPR_19 [PF14559], Evalue: 0.0028, Aligned region: 104..131
Protein Sequence: 270 a.a.     [Download]
>gi|392979523|ref|YP_006478111.1| type VI secretion system protein ImpE [Enterobacter cloacae subsp. dissolvens SDM]
MNTLYQHLAGESLSDALVRLENEIKARPADADLRAAFVQFLTLSGNWTRALTQLKSWLALKPQAKPTVTL
LEQCLQGELQRAQVMAGERRPAMPEAQWPWLTTLAAALSESDERAHALRLEALEQAQASAGQLTLENDET
QAFEWLMDGDARLGPVCETLVNGRYFWLPFSAIAEIRFQAPASVTDLVWRHALVRLTDGTEQVCQIPARY
PFAANASDAVKLGRTTEWLPLDNDGTLYEGLGQKVWLSEQSESPLLSLSLVTFATDGAHE
 
Nucleotide Sequence: 813 bp     [Download]
>gi|392976867|ref|NC_018079.1|:c2887074-2886262 Enterobacter cloacae subsp. dissolvens SDM chromosome, complete genome
ATGAATACGCTCTATCAACATCTGGCGGGGGAGTCGCTCAGCGACGCGCTGGTGCGTCTTGAAAACGAGA
TTAAAGCCCGTCCGGCGGATGCCGATCTCCGTGCCGCGTTTGTGCAGTTTCTCACCCTCAGCGGTAACTG
GACGCGTGCGCTGACCCAGCTGAAAAGCTGGCTGGCGCTTAAGCCGCAGGCGAAACCCACTGTCACCCTG
CTGGAACAGTGCCTGCAGGGAGAACTGCAGCGTGCGCAGGTGATGGCGGGAGAACGGCGTCCGGCCATGC
CGGAAGCCCAGTGGCCATGGCTGACCACCCTTGCCGCCGCGCTGAGCGAGAGCGATGAACGCGCTCACGC
GCTGCGTCTGGAAGCCCTTGAACAGGCGCAGGCGAGCGCGGGTCAGTTGACGCTTGAGAATGATGAGACG
CAGGCCTTTGAATGGCTGATGGACGGCGATGCCCGTCTGGGGCCGGTGTGCGAAACCCTTGTTAACGGCC
GTTACTTCTGGCTGCCGTTTAGCGCTATCGCGGAGATCCGTTTCCAGGCTCCGGCCAGCGTCACCGATCT
GGTCTGGCGTCATGCGCTGGTGCGTTTGACCGACGGGACGGAGCAGGTGTGCCAGATCCCGGCGCGTTAT
CCTTTTGCGGCCAATGCTTCTGACGCCGTTAAACTCGGGCGCACCACCGAGTGGTTGCCGCTCGACAATG
ACGGCACGCTGTATGAAGGGCTGGGGCAGAAAGTCTGGCTCAGCGAGCAAAGCGAAAGCCCGCTGCTGTC
GCTGAGTCTCGTCACTTTTGCAACGGATGGAGCCCATGAGTAA