SecReT6
Protein ID: 392979526
SecReT6 ID673
T6SS typei3
Gene symbol-
Locus tagA3UG_13430
StrainEnterobacter cloacae subsp. dissolvens SDM
Repliconchromosome [GenBank: NC_018079] [Browse all T6SS(s) in this replicon]
Location [Strand]2888881..2890650 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDI6RAH7
KEGG IDenl:A3UG_13430
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.30E-09, Aligned region: 27..93
UreE_N [PF02814], Evalue: 0.0033, Aligned region: 28..49
UreE_N [PF02814], Evalue: 0.0033, Aligned region: 78..99
Protein Sequence: 589 a.a.     [Download]
>gi|392979526|ref|YP_006478114.1| FHA domain-containing protein [Enterobacter cloacae subsp. dissolvens SDM]
MRFTIISTKPGHQPPQSSCDFYAPGGTIGRGTDNNLVLPDNDRTISRLQAIVHVDAQGECRVTNRGSVTR
VVLNDIPLERGRQVELQDGDILGIDDYRIEVTELIHDTQPVSRMAASMQQQARPTVAPTPAPQPKPASAA
PRGKAEPTAVPSEIWDSLMQEFSISDSISSNRVKPQPAASHDPFSQPAAPERNAEDPLAMFNDSEPKLER
KNVDPDTLFSDEALFKKESIFDDVTPSTLVPPVESKPEPAEEATDELDPLALFGGSASAPAARNDDPLGL
MGGAPLTHPDEIVPEPSAPAPEPEAVPQDDPLADSPLFAPEPQDPPRAEEEEPARTDYAGFTMPTPQAVA
RSSAQTPKGRLRIDPVKNAAAPSATAQNGEKGEVLQGELLEALLEGMGLSEMQPVPQFDRENMRQLGQIL
GMFSQGTVALLSSRSILKRGVKADMTMVLDDANNPFKLLPTGKTVLIQMFGTPMPGFMPPTKSVRDALID
LQAHQLGMISGIRAIIAAMLQSFNPEQLEEQAKQNGMTSRLALPGSRKAALWDYFVRSYGETAGEIEDDF
HTLFGEAFLHAYDMEVNQYKDSQSGSEEK
 
Nucleotide Sequence: 1770 bp     [Download]
>gi|392976867|ref|NC_018079.1|:c2890650-2888881 Enterobacter cloacae subsp. dissolvens SDM chromosome, complete genome
ATGCGATTCACGATTATTTCTACGAAACCCGGTCATCAGCCGCCGCAGAGCAGTTGTGATTTTTATGCCC
CCGGGGGCACTATTGGGCGCGGTACGGATAACAATCTGGTACTGCCGGACAATGACCGCACCATCTCGCG
CCTGCAGGCCATTGTTCACGTTGACGCCCAGGGCGAATGCCGCGTGACCAACCGTGGCAGCGTCACCCGC
GTGGTGTTGAACGACATCCCGCTGGAGCGGGGGCGTCAGGTAGAGCTGCAGGACGGGGATATTCTCGGTA
TTGATGACTACCGCATCGAAGTGACGGAACTTATCCACGACACGCAGCCGGTGAGCCGCATGGCCGCCAG
TATGCAGCAGCAGGCTCGCCCGACAGTGGCGCCGACACCTGCTCCACAGCCAAAGCCAGCCAGTGCCGCA
CCGCGCGGCAAGGCGGAGCCAACGGCCGTGCCGTCGGAAATCTGGGACAGCCTGATGCAGGAGTTCTCTA
TCTCTGACAGCATCTCCAGCAACCGCGTGAAACCGCAGCCTGCGGCGTCTCACGATCCCTTCTCGCAACC
CGCGGCACCCGAGCGTAACGCTGAAGATCCGCTGGCAATGTTCAACGACAGCGAGCCGAAGCTTGAGCGT
AAGAACGTCGATCCCGACACGTTGTTCAGCGATGAAGCGTTATTCAAAAAAGAGAGCATCTTTGACGATG
TCACCCCTTCAACGCTGGTGCCGCCGGTAGAGAGCAAACCCGAACCGGCAGAAGAGGCAACGGATGAACT
CGATCCGCTGGCCCTGTTTGGTGGTTCGGCCAGCGCGCCAGCCGCGCGTAACGATGATCCGCTTGGGCTG
ATGGGCGGGGCGCCGTTAACTCATCCGGATGAGATCGTACCTGAGCCATCTGCACCAGCGCCAGAGCCAG
AGGCCGTACCGCAGGACGATCCGCTGGCGGATTCTCCGCTGTTTGCCCCTGAGCCACAGGACCCACCGCG
TGCGGAAGAGGAAGAGCCGGCACGTACCGATTACGCAGGCTTTACTATGCCTACGCCGCAGGCCGTCGCA
CGCAGCAGCGCACAGACGCCGAAGGGACGTCTGCGTATCGACCCGGTCAAAAACGCGGCTGCGCCAAGCG
CTACGGCGCAAAACGGTGAAAAAGGCGAGGTGCTGCAGGGCGAGCTGCTGGAGGCGCTGCTGGAGGGGAT
GGGCCTGAGCGAAATGCAGCCGGTGCCGCAGTTTGACCGTGAAAATATGCGTCAGCTGGGCCAGATCCTC
GGCATGTTCTCGCAGGGCACCGTGGCGTTGCTCTCTTCGCGCTCTATCCTCAAGCGCGGCGTAAAAGCCG
ATATGACCATGGTGCTCGACGATGCCAACAACCCGTTCAAGCTGCTGCCGACCGGGAAAACGGTCCTAAT
TCAGATGTTCGGGACGCCGATGCCGGGCTTTATGCCACCCACCAAATCCGTGCGTGACGCGCTGATCGAT
CTGCAGGCGCATCAGCTGGGGATGATCTCCGGTATCCGCGCCATCATCGCCGCGATGCTGCAATCCTTTA
ACCCGGAACAGCTGGAAGAGCAGGCGAAGCAGAACGGTATGACCTCCCGTCTGGCGCTGCCGGGCAGCCG
CAAAGCCGCGCTGTGGGACTACTTTGTCCGCAGCTATGGCGAGACGGCCGGTGAGATTGAAGATGACTTC
CACACCCTGTTTGGCGAAGCGTTCCTTCATGCCTATGACATGGAGGTCAATCAGTACAAAGACTCACAGA
GCGGATCGGAAGAAAAATGA