SecReT6
Protein ID: 392979532
SecReT6 ID673
T6SS typei3
Gene symbol-
Locus tagA3UG_13460
StrainEnterobacter cloacae subsp. dissolvens SDM
Repliconchromosome [GenBank: NC_018079] [Browse all T6SS(s) in this replicon]
Location [Strand]2893295..2894794 [-]
Producttype VI secretion system protein ImpC
NoteTssC
UniProt IDI6SFN0
KEGG IDenl:A3UG_13460
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.90E-196, Aligned region: 66..492
Protein Sequence: 499 a.a.     [Download]
>gi|392979532|ref|YP_006478120.1| type VI secretion system protein ImpC [Enterobacter cloacae subsp. dissolvens SDM]
MSNQTQQHEQQAGQAFSQDEFSALLNKEFRPKTDQARSAVESAVKTLAQQALENTVTFSNDTYRTIQNLI
AGIDEQLSQQVNQIIHHDEFQKLESAWRGLSYLVNNTETDEMLKIRFMSISKQELGRTLKRYKGVGWDQS
PIFKKIYEQEYGQFGGEPFGCIVGDYYFDHSPQDVELLGEMARIGSAAHCPFITGTAPGVMQMESWQELA
NPRDLTKIFQNTEYAAWRSLRESEDARYLGLVMPRFLSRLPYGIRTNPVDSFDFEEQTDGANHNSYAWAN
AAYAMAANINRSFKEYGWCTSIRGVESGGAVENLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGFM
PLVHRKNSDFAAFIGAQSLQKPAEYHDPDATANARLASRLPYLFACCRFAHYLKCIVRDKIGSFREREEM
ERWLNDWVMNYVDGDPANSSQETKSRKPLAAAEVQVQEIEDNPGYYAAKFFLRPHYQLEGLTVSLRLVSK
LPSLKTKDA
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|392976867|ref|NC_018079.1|:c2894794-2893295 Enterobacter cloacae subsp. dissolvens SDM chromosome, complete genome
ATGAGCAACCAGACTCAACAACACGAGCAGCAGGCAGGTCAGGCGTTCAGCCAGGACGAGTTCAGCGCGC
TGCTGAACAAAGAGTTCCGCCCTAAAACTGACCAGGCGCGTTCCGCCGTTGAGAGCGCGGTAAAAACTCT
GGCGCAGCAGGCGCTGGAAAATACCGTTACTTTCTCCAACGACACCTATCGCACCATCCAGAACCTGATC
GCCGGTATCGACGAACAGCTGTCTCAGCAGGTGAATCAGATCATTCACCACGACGAGTTTCAGAAGCTGG
AGAGCGCCTGGCGCGGTCTGAGCTACCTGGTGAACAACACTGAAACCGACGAGATGCTGAAGATCCGCTT
TATGAGCATCTCCAAGCAGGAGCTGGGCCGCACCCTGAAACGCTATAAGGGTGTGGGCTGGGATCAGAGC
CCGATCTTCAAGAAAATCTACGAGCAGGAGTACGGTCAGTTTGGTGGTGAGCCGTTTGGCTGCATCGTTG
GCGACTATTACTTTGACCACAGCCCGCAGGACGTTGAACTGCTGGGTGAAATGGCGCGCATCGGCTCTGC
GGCCCACTGTCCGTTCATCACCGGTACCGCACCGGGCGTGATGCAGATGGAGTCCTGGCAGGAACTGGCT
AACCCGCGCGATCTGACCAAAATCTTCCAGAACACCGAATACGCCGCCTGGCGTTCACTGCGTGAATCGG
AAGATGCCCGCTATCTGGGCCTGGTGATGCCGCGCTTCCTGTCGCGTCTGCCTTACGGCATTCGTACTAA
CCCGGTCGACAGCTTTGACTTTGAAGAGCAGACCGACGGCGCGAACCACAACAGCTACGCCTGGGCGAAC
GCCGCTTACGCGATGGCCGCTAACATCAACCGCTCTTTCAAAGAGTACGGCTGGTGCACCTCGATTCGCG
GCGTGGAGTCCGGCGGGGCGGTCGAAAACCTGCCGTGCCACACCTTCCCGAGCGATGACGGCGGCGTGGA
CATGAAATGTCCGACCGAGATCGCCATCAGCGACCGTCGTGAAGCCGAGCTGGCGAAAAACGGCTTTATG
CCGCTGGTTCACCGCAAAAACTCCGACTTTGCTGCCTTTATCGGCGCGCAGTCGCTGCAAAAACCGGCGG
AGTACCATGACCCGGATGCCACCGCCAACGCGCGTCTGGCCTCCCGTCTGCCGTACCTGTTCGCCTGCTG
CCGCTTTGCGCATTACCTGAAGTGCATCGTGCGTGACAAAATCGGCTCCTTCCGCGAGCGCGAAGAGATG
GAACGCTGGCTGAACGACTGGGTCATGAACTACGTGGACGGTGACCCGGCCAACTCCTCTCAGGAGACCA
AGTCCCGCAAGCCGCTGGCCGCTGCAGAAGTGCAGGTGCAGGAGATTGAAGACAACCCGGGCTACTACGC
CGCGAAGTTCTTCCTGCGTCCGCACTACCAGCTGGAAGGTCTGACCGTTTCTCTGCGTCTGGTATCTAAA
CTGCCGTCGCTGAAGACGAAAGACGCGTAA