SecReT6
Protein ID: 392979533
SecReT6 ID673
T6SS typei3
Gene symbol-
Locus tagA3UG_13465
StrainEnterobacter cloacae subsp. dissolvens SDM
Repliconchromosome [GenBank: NC_018079] [Browse all T6SS(s) in this replicon]
Location [Strand]2894798..2895322 [-]
Producthypothetical protein
NoteTssB
UniProt IDI6S6P2
KEGG IDenl:A3UG_13465
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.00E-61, Aligned region: 11..162
Protein Sequence: 174 a.a.     [Download]
>gi|392979533|ref|YP_006478121.1| hypothetical protein A3UG_13465 [Enterobacter cloacae subsp. dissolvens SDM]
MAMSNSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVMADLVGKPVENLPAVDERKFLEIDIDNF
DERMKALKPRVAFQVDNTLTGEGKLNVDLTFDSMDDFLPDAVARKVEPLNKLLEARTQLSNLLTYMDGKN
GAEELIAKILQDPTLLKSLSQLPKNDESAKGSEE
 
Nucleotide Sequence: 525 bp     [Download]
>gi|392976867|ref|NC_018079.1|:c2895322-2894798 Enterobacter cloacae subsp. dissolvens SDM chromosome, complete genome
ATGGCAATGAGTAACAGTGGGCAGAAATTTATCGCACGTAACCGTGCCCCCCGCGTGCAGATCGAGTACG
ACGTAGAGATCTACGGTGCAGAACGTAAAATTCAGCTGCCGTTCGTGATGGGCGTTATGGCCGATCTGGT
CGGCAAACCGGTGGAAAATCTGCCGGCCGTCGATGAGCGTAAATTCCTCGAAATCGACATCGATAACTTT
GACGAACGCATGAAGGCGCTTAAGCCGCGCGTGGCGTTCCAGGTGGACAACACCCTGACCGGCGAAGGCA
AGCTCAACGTCGATCTGACCTTCGACAGCATGGACGACTTCCTGCCGGATGCGGTGGCCCGCAAGGTTGA
ACCGCTGAACAAGCTGCTGGAAGCGCGTACTCAGCTTTCCAATCTGCTGACCTACATGGACGGTAAAAAC
GGCGCGGAAGAGCTGATCGCTAAAATTCTGCAGGATCCGACGCTGCTCAAATCCCTGAGCCAGTTGCCGA
AAAATGACGAAAGTGCGAAAGGTAGCGAGGAGTAA