SecReT6
Protein ID: 392979534
SecReT6 ID673
T6SS typei3
Gene symbol-
Locus tagA3UG_13470
StrainEnterobacter cloacae subsp. dissolvens SDM
Repliconchromosome [GenBank: NC_018079] [Browse all T6SS(s) in this replicon]
Location [Strand]2895398..2896414 [-]
Producttype VI secretion system protein ImpA
NoteTssA
UniProt IDI6RLB6
KEGG IDenl:A3UG_13470
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.50E-20, Aligned region: 52..111
Protein Sequence: 338 a.a.     [Download]
>gi|392979534|ref|YP_006478122.1| type VI secretion system protein ImpA [Enterobacter cloacae subsp. dissolvens SDM]
MNIEEFLAPISPEKPCGDNLEYDADFQAMGQASQGKAEQQFGDTIIPAEPADWNTVEKLATSLLGRTKDL
RVMLALTHAWTRRRGLPGYADGLLLVQEAITRYWEPLYPLLEEYGETDPFYRINALAALSDKSDLTVALR
NASLLRSNGDEISLRDAQALLDGSKTECPDYPGGRPRLIDELARGDQPGTEAVILINERLLAIRDLLSGY
LGESGVPEMEQLLKTVGLVASACQVTDISKLLPNRDAQAEHHAEPQTMATQPVQQVTDWRSVQVTSRADA
QLMLEKAKQYFAQYEPSHPAPLMIERVQRLSELNFMDIIRDLAPDGVNQLENIFGRRE
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|392976867|ref|NC_018079.1|:c2896414-2895398 Enterobacter cloacae subsp. dissolvens SDM chromosome, complete genome
ATGAATATCGAAGAATTTCTCGCGCCGATAAGCCCCGAAAAACCCTGCGGTGACAACCTTGAGTACGACG
CCGATTTTCAGGCTATGGGACAGGCAAGCCAGGGTAAAGCGGAACAGCAGTTCGGCGACACGATCATTCC
CGCCGAACCCGCTGACTGGAATACGGTAGAAAAGCTCGCCACCAGCCTGCTGGGGCGCACCAAAGATCTT
CGCGTCATGCTGGCGTTAACCCACGCCTGGACCCGACGTCGTGGGCTGCCGGGCTACGCGGACGGCCTGC
TGCTGGTGCAGGAGGCGATCACCCGCTACTGGGAGCCGCTCTATCCACTGCTGGAGGAGTATGGCGAAAC
GGACCCGTTCTATCGCATTAACGCCCTTGCCGCGCTGAGCGATAAATCTGACCTGACCGTCGCGCTGCGT
AACGCCTCGTTGCTGCGCTCAAACGGCGATGAAATTTCGCTGCGTGACGCGCAGGCATTGCTGGATGGCA
GCAAAACCGAATGCCCGGATTATCCCGGCGGCCGCCCAAGACTGATTGACGAACTGGCGCGCGGCGACCA
GCCAGGTACAGAGGCCGTCATCCTGATTAATGAAAGGCTGCTGGCCATTCGCGATCTGCTCAGCGGTTAC
CTTGGTGAAAGCGGCGTACCAGAAATGGAGCAGTTGCTGAAAACCGTGGGGCTGGTCGCGAGCGCCTGTC
AGGTGACTGACATCAGCAAGCTGCTGCCCAATCGGGATGCACAGGCCGAACACCACGCTGAGCCGCAGAC
GATGGCAACACAACCCGTGCAGCAGGTCACCGACTGGCGCAGCGTGCAGGTCACCAGTCGCGCCGACGCC
CAGCTGATGCTGGAGAAAGCGAAACAGTATTTTGCGCAGTACGAACCGAGCCACCCTGCACCGCTGATGA
TTGAACGGGTGCAGCGGCTGTCAGAACTTAACTTTATGGACATTATTCGCGACCTGGCGCCAGACGGCGT
TAACCAACTGGAAAACATCTTTGGACGCCGCGAATAA