SecReT6
Protein ID: 392979537
SecReT6 ID673
T6SS typei3
Gene symbol-
Locus tagA3UG_13485
StrainEnterobacter cloacae subsp. dissolvens SDM
Repliconchromosome [GenBank: NC_018079] [Browse all T6SS(s) in this replicon]
Location [Strand]2900782..2902020 [-]
Producthypothetical protein
NoteTssL
UniProt IDI6SFN5
KEGG IDenl:A3UG_13485
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.60E-69, Aligned region: 20..225
DUF2077 [PF09850], Evalue: 3.60E-69, Aligned region: 369..389
OmpA [PF00691], Evalue: 2.10E-14, Aligned region: 290..388
Protein Sequence: 412 a.a.     [Download]
>gi|392979537|ref|YP_006478125.1| hypothetical protein A3UG_13485 [Enterobacter cloacae subsp. dissolvens SDM]
MQERQDTGSDAAFTGASSNNQLVAAANPLLNAIPQIRHSVSHDDQVALRQRLIDEIRRFEVRCQQAGLAY
EVIVGARYCLCTALDEAAALTPWGSSGVWSSNGLLVTFHNETWGGEKFFQLLARLSQNPREHILLLEMIN
YCLLLGFEGRYRVLDNGRTQLETIKQRLWQMIRGVRGSYPAPLSPHPEDRPVLRKLWRPMVPLWACVALA
GFIACLFYIILNWRLGDNTNPVLAKIYQSQLPETTIQQPARQLPAVLNLRGFLKPEIDAGLVAVKDEADR
SVVILKGDGLFASASTVVRDRYEPVINRIAQAMNNVSGKILVVGYSDNVPIRSARFASNYELSLDRARSV
QKMLQGSLSQPDRVKAEGRGEINPVAPNNTPENRARNRRVEITLLVSPENTQAELNGLPQGN
 
Nucleotide Sequence: 1239 bp     [Download]
>gi|392976867|ref|NC_018079.1|:c2902020-2900782 Enterobacter cloacae subsp. dissolvens SDM chromosome, complete genome
ATGCAGGAACGACAGGATACCGGCAGTGATGCCGCGTTTACCGGAGCCAGTAGCAACAATCAGCTGGTGG
CGGCCGCCAATCCGCTGCTCAACGCGATTCCGCAAATCCGTCATTCGGTGTCTCATGACGATCAGGTGGC
GCTGCGCCAGCGTCTGATCGACGAGATTCGCCGTTTCGAAGTCCGCTGCCAGCAGGCAGGACTGGCGTAT
GAGGTGATCGTCGGGGCGCGCTATTGCCTCTGTACGGCGCTGGATGAAGCCGCGGCGCTGACCCCCTGGG
GCAGCAGCGGTGTCTGGTCAAGCAATGGTCTGCTGGTCACGTTTCATAACGAAACCTGGGGCGGCGAAAA
GTTCTTCCAGCTGCTGGCGCGTCTGTCGCAGAACCCGCGTGAACATATCCTCCTGCTGGAGATGATCAAC
TACTGCCTGCTGCTCGGTTTCGAAGGCCGCTATCGGGTTCTGGATAATGGTCGCACCCAGCTTGAAACCA
TCAAGCAGCGGCTGTGGCAGATGATCCGCGGCGTGCGCGGCAGCTATCCGGCACCGCTCTCTCCACACCC
GGAAGATCGTCCGGTGCTGCGCAAGCTGTGGCGGCCGATGGTGCCGCTGTGGGCCTGTGTCGCGCTGGCC
GGGTTTATCGCCTGCCTGTTCTACATCATTCTCAACTGGCGTCTTGGCGACAACACCAACCCGGTACTGG
CGAAGATTTACCAGTCTCAGTTGCCTGAAACCACCATTCAGCAACCTGCGCGTCAACTGCCTGCGGTGCT
CAACCTGCGTGGCTTCCTGAAGCCGGAAATCGATGCCGGTCTGGTGGCGGTGAAGGACGAAGCGGATCGC
AGCGTGGTGATCCTGAAAGGAGACGGTCTGTTCGCTTCTGCTTCTACCGTGGTGCGTGACCGCTATGAGC
CGGTTATCAACCGGATTGCCCAGGCAATGAACAACGTCAGCGGCAAAATTCTGGTGGTGGGCTACAGCGA
TAACGTGCCAATTCGCAGCGCGCGCTTCGCCTCCAACTATGAACTCTCTTTGGATCGTGCCCGGTCCGTG
CAAAAAATGCTGCAGGGAAGCCTCTCGCAGCCTGACCGCGTGAAAGCGGAAGGGCGAGGAGAGATCAATC
CTGTTGCGCCAAACAATACGCCTGAAAACCGCGCCCGTAACCGCCGTGTGGAAATAACTCTGCTGGTGTC
GCCTGAAAATACGCAGGCTGAGCTGAACGGATTGCCGCAAGGAAACTAA