SecReT6
Protein ID: 392979538
SecReT6 ID673
T6SS typei3
Gene symbol-
Locus tagA3UG_13490
StrainEnterobacter cloacae subsp. dissolvens SDM
Repliconchromosome [GenBank: NC_018079] [Browse all T6SS(s) in this replicon]
Location [Strand]2902038..2903381 [-]
Producttype VI secretion system protein ImpJ
NoteTssK
UniProt IDI6S6P6
KEGG IDenl:A3UG_13490
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.50E-138, Aligned region: 19..443
Protein Sequence: 447 a.a.     [Download]
>gi|392979538|ref|YP_006478126.1| type VI secretion system protein ImpJ [Enterobacter cloacae subsp. dissolvens SDM]
MSKAEKVVWTEGMFLRPHHFQRTESYLLNHVREWGALQRSYLWGFLDVELDEAMLRQGCIALSYCSGVLP
DGTFFQVRNGRNGPAPLKIPDNLTNEKVVLALPVRRGEREEVIFSEEPASLARFIAFEQEVEDDNAMSVG
DATVQFGRLRLTLMLEKDLTAEWTAIGIAFVAEKRNDNHVRLDSSYIPPMLNACNSPQLYSMVNDLHGLL
VQRSQQIGGRLRQPGRFNTSELIEFTLLSLVNRHLGEVSHLKTLPLLHPETLWRSWLPFATELATWTSQR
TAESVLPIYDHDDLAGCFSKLMLMLRQGLSLVMEDQAIQLPLNERSHGLNIATVPETSMVREFGFVLAVK
ANVPGEHLQTHFPAQMKVAPVSKIRDLVQLQLPGIMLRAMPVAPPQIPWHAGYSYFELEKGSELWHEMDK
SGAFALHLAGEFPGLDMEFWAIRSPTE
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|392976867|ref|NC_018079.1|:c2903381-2902038 Enterobacter cloacae subsp. dissolvens SDM chromosome, complete genome
ATGAGCAAAGCAGAGAAGGTCGTCTGGACCGAAGGCATGTTCCTGCGTCCACACCATTTTCAACGGACAG
AAAGTTATCTGCTCAACCACGTTCGGGAATGGGGTGCGCTGCAGCGATCGTATCTCTGGGGCTTCCTCGA
TGTTGAACTGGACGAAGCGATGCTTCGCCAGGGGTGCATTGCCCTGAGCTACTGCAGCGGTGTGCTGCCA
GACGGCACCTTTTTCCAGGTTCGCAACGGGCGTAACGGCCCGGCCCCCCTGAAAATTCCTGACAATCTCA
CCAATGAAAAGGTGGTGCTCGCGCTGCCGGTACGTCGGGGAGAGCGTGAAGAGGTTATTTTCAGCGAGGA
GCCCGCGTCACTGGCGCGTTTCATCGCCTTCGAGCAGGAGGTGGAAGACGATAACGCCATGTCGGTGGGG
GATGCTACGGTGCAGTTTGGCCGTTTACGTCTGACCCTGATGCTGGAAAAAGATCTGACGGCCGAATGGA
CGGCGATTGGCATCGCGTTCGTCGCGGAAAAGCGTAACGACAACCATGTGCGTCTGGATAGCAGCTACAT
TCCGCCGATGCTGAACGCCTGCAACAGCCCGCAACTCTACAGCATGGTAAACGATCTGCACGGCTTGCTG
GTGCAACGTAGCCAGCAGATTGGTGGTCGTCTGCGCCAGCCTGGCCGCTTTAACACCTCCGAGCTGATCG
AATTTACGCTGCTGTCGCTGGTTAACCGTCACCTGGGCGAAGTCTCCCATTTAAAAACGCTCCCGCTGCT
GCACCCGGAAACACTCTGGCGCAGCTGGCTGCCGTTTGCCACGGAGCTTGCCACCTGGACCTCGCAACGC
ACCGCCGAAAGCGTGCTGCCGATTTACGATCACGACGACCTTGCGGGATGCTTCAGCAAGCTGATGCTGA
TGCTGCGTCAGGGGCTGTCGCTGGTGATGGAAGATCAGGCCATTCAGCTGCCGCTGAACGAGCGCTCCCA
TGGGCTGAACATCGCCACGGTACCGGAGACCAGCATGGTGCGCGAGTTCGGCTTCGTCCTGGCAGTCAAA
GCCAACGTGCCGGGCGAGCACCTGCAAACCCATTTCCCTGCCCAGATGAAAGTCGCGCCGGTGTCGAAAA
TCCGCGATCTGGTTCAGTTACAGCTGCCGGGCATTATGCTGCGCGCCATGCCGGTTGCGCCGCCGCAGAT
CCCATGGCATGCGGGCTACAGCTACTTTGAGCTGGAGAAGGGCAGTGAGCTGTGGCACGAGATGGATAAG
TCCGGTGCATTCGCCCTGCATCTCGCAGGGGAGTTCCCGGGTCTTGATATGGAGTTTTGGGCCATCCGTA
GCCCGACTGAATAA