SecReT6
Protein ID: 392979539
SecReT6 ID673
T6SS typei3
Gene symbol-
Locus tagA3UG_13495
StrainEnterobacter cloacae subsp. dissolvens SDM
Repliconchromosome [GenBank: NC_018079] [Browse all T6SS(s) in this replicon]
Location [Strand]2903410..2903913 [-]
Producttype VI secretion system protein VasD
NoteTssJ
UniProt IDI6RLB8
KEGG IDenl:A3UG_13495
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.60E-30, Aligned region: 19..142
Protein Sequence: 167 a.a.     [Download]
>gi|392979539|ref|YP_006478127.1| type VI secretion system protein VasD [Enterobacter cloacae subsp. dissolvens SDM]
MNNRNFHKLLFVFYAVIFALVSGCTSSSHSDPSRYNLQFQAHPQINDSAPLKVRVLLLKSDADFMSSDFY
SLQNNASATLGANLLNSDVFFLMPGQLSKTLSGQSSPDARYIGVMAEYQMLDGKKWRVSLPLPVPGENHL
YQFWKWSSDELQANVFLDINGIRVISQ
 
Nucleotide Sequence: 504 bp     [Download]
>gi|392976867|ref|NC_018079.1|:c2903913-2903410 Enterobacter cloacae subsp. dissolvens SDM chromosome, complete genome
ATGAATAATAGAAATTTTCATAAGCTGTTGTTCGTCTTTTACGCGGTGATTTTCGCCCTGGTCAGTGGTT
GTACGTCGTCTTCACACAGCGACCCCTCCCGCTACAATCTGCAGTTTCAGGCTCATCCACAAATTAATGA
TTCTGCGCCGCTTAAAGTCAGAGTGCTGCTGTTGAAGTCCGATGCGGATTTCATGTCCAGTGACTTCTAT
TCCCTGCAGAACAACGCGTCAGCCACGCTTGGCGCGAATCTGCTGAACAGCGATGTTTTCTTCCTGATGC
CGGGCCAGCTTTCGAAAACCCTCAGCGGCCAAAGCTCACCCGACGCGCGCTATATCGGTGTTATGGCCGA
GTATCAGATGCTGGATGGAAAGAAATGGCGTGTTTCACTCCCACTGCCTGTACCAGGCGAAAACCATCTC
TACCAGTTCTGGAAATGGTCATCTGATGAACTTCAGGCCAACGTCTTTCTCGACATAAATGGCATCCGGG
TCATCAGCCAGTAA