SecReT6
Protein ID: 392981495
SecReT6 ID674
T6SS typei3
Gene symbol-
Locus tagPADK2_00425
StrainPseudomonas aeruginosa DK2
Repliconchromosome [GenBank: NC_018080] [Browse all T6SS(s) in this replicon]
Location [Strand]97407..98918 [-]
Producthypothetical protein
NoteFha
UniProt IDI6RRI9
KEGG IDpdk:PADK2_00425
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.60E-15, Aligned region: 29..97
Protein Sequence: 503 a.a.     [Download]
>gi|392981495|ref|YP_006480082.1| hypothetical protein PADK2_00425 [Pseudomonas aeruginosa DK2]
MPLRLTITSYHKLTPGQCSEKVLDQGQLTIGRGPDNDWVLPDPERLVSSRHCTILNRDGVYYLTDTSTNG
VLLVNAGHRLRRGNSEPLQDGETVRLGEYDILVQFGHDIALPGSGNPQTDPFTSFDALMSRQAAGSAPAF
AEPAPTPHPAVTAHFQGGSPLDTKPDLFDFLTPPPPGAAPRPDHVPAEQHDFRPPEPVIPPPPATTPAPP
PAGGAPLIPADWDPFAELLGNTPAPSATPVVQPLPAAEPTPLAMPFADPGITQQPQPQPQPQPQPQPQPQ
PQPQPQPQPQPASVAAPTPPASAAASAGGNLLQAFLRGAGMTQLKVDPAGAEAQMEAIGRSYRGLVEGLV
DVLRARASLKGEFRMAQTMIQPVQNNPLKFAPNVDEAMLLLLRRDNQAFMAPDRAVADSFEDLKAHQLAV
MAGVQAAIRHLLARFEPAALEARFGKPAGLSGLLPGARQAQNWDSFTELYAKILREAEDDFQELFGREFS
RAYEEHSARLRRS
 
Nucleotide Sequence: 1512 bp     [Download]
>gi|392981410|ref|NC_018080.1|:c98918-97407 Pseudomonas aeruginosa DK2 chromosome, complete genome
ATGCCGCTGCGATTGACCATCACCAGCTACCACAAGCTGACCCCCGGTCAGTGTTCGGAAAAGGTACTGG
ACCAGGGACAGCTGACCATCGGTCGGGGCCCGGACAACGACTGGGTCCTGCCGGACCCGGAGCGCCTGGT
CTCCAGCCGCCACTGCACCATCCTCAACCGCGACGGGGTGTACTACCTCACCGACACCAGCACCAACGGC
GTGCTGCTGGTCAATGCCGGGCACCGCCTGCGCCGCGGCAACAGCGAGCCGCTGCAGGACGGCGAGACCG
TCCGCCTCGGCGAATACGACATCCTCGTCCAGTTCGGCCATGACATCGCCCTGCCCGGCAGCGGCAATCC
GCAGACCGATCCGTTCACCAGCTTCGACGCCCTGATGAGCCGGCAGGCCGCCGGATCGGCGCCTGCCTTC
GCCGAACCGGCGCCCACCCCGCACCCCGCGGTGACGGCGCATTTCCAGGGCGGCTCGCCGCTGGACACCA
AGCCCGACCTGTTCGACTTCCTCACCCCGCCGCCGCCCGGCGCGGCGCCGCGTCCGGACCATGTACCGGC
CGAACAGCACGACTTCCGCCCGCCGGAACCGGTGATCCCGCCGCCCCCCGCGACCACCCCGGCGCCACCG
CCCGCTGGCGGCGCACCGCTGATTCCGGCCGACTGGGACCCGTTCGCCGAACTGCTCGGCAACACGCCCG
CGCCAAGCGCCACGCCCGTCGTCCAGCCGCTGCCGGCGGCCGAACCGACGCCGCTGGCGATGCCCTTCGC
CGACCCGGGGATCACCCAACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAG
CCACAGCCACAGCCACAGCCACAGCCACAGCCAGCGAGCGTGGCGGCGCCGACGCCGCCGGCAAGCGCCG
CCGCGTCGGCCGGCGGCAACCTGCTGCAAGCGTTCCTGCGCGGCGCCGGCATGACCCAGTTGAAGGTCGA
CCCGGCCGGCGCCGAAGCGCAGATGGAAGCCATCGGCCGCAGCTATCGCGGCCTGGTGGAAGGACTGGTG
GACGTGCTGCGCGCGCGGGCCAGCCTGAAGGGCGAGTTCCGCATGGCGCAGACCATGATCCAGCCGGTGC
AGAACAACCCGCTGAAGTTCGCGCCGAACGTCGACGAGGCCATGCTGCTCCTGCTGCGCCGCGACAACCA
GGCGTTCATGGCGCCGGATCGCGCGGTGGCCGACAGCTTCGAAGACCTCAAGGCACACCAGCTGGCGGTG
ATGGCCGGCGTGCAGGCCGCCATCCGCCACCTGCTGGCGCGCTTCGAACCGGCCGCGCTGGAAGCCCGCT
TCGGCAAGCCGGCCGGGCTTTCCGGCCTGCTGCCGGGGGCCCGCCAGGCACAGAACTGGGACAGTTTCAC
CGAGCTGTACGCGAAGATCCTGCGCGAGGCGGAGGACGACTTCCAAGAGCTTTTCGGCCGCGAATTCAGC
CGCGCCTACGAGGAACACAGCGCTCGACTACGGCGTTCCTGA