SecReT6
Protein ID: 392981496
SecReT6 ID674
T6SS typei3
Gene symbol-
Locus tagPADK2_00430
StrainPseudomonas aeruginosa DK2
Repliconchromosome [GenBank: NC_018080] [Browse all T6SS(s) in this replicon]
Location [Strand]99304..100320 [+]
Producthypothetical protein
NoteTssA
UniProt IDI6SQ32
KEGG IDpdk:PADK2_00430
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.10E-18, Aligned region: 48..107
ImpA-rel_N [PF06812], Evalue: 3.10E-18, Aligned region: 150..162
Protein Sequence: 338 a.a.     [Download]
>gi|392981496|ref|YP_006480083.1| hypothetical protein PADK2_00430 [Pseudomonas aeruginosa DK2]
MLAAVSPDSPCGDDLEYDAAFLELERIAQGQPERQMGDAVLPAEPPEWPRVRALASELFGRSKDLRVANL
LLQSNVALDGLDGLADGLLLVRELLGQYWDGVYPLLDADDDNDPTFRINALTGLVAEPLLQLVWAIPLVR
SRAFGPVNLRAALNAAGLQRFASETLSPEQIAGAFADADADALAATRRALEGAQEHALAIESGVAERVGS
AQGLDLGPLRQLLRQALQVFDLYGPQGAGEPLAPGAEAAADEQGGAAPVAAVAAPAPRASGEIANREDVL
RQLDRLLEYYVRHEPSSPVPVLLKRAKTLVTADFAEIVRNLIPDGISQFETLRGPESE
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|392981410|ref|NC_018080.1|:99304-100320 Pseudomonas aeruginosa DK2 chromosome, complete genome
TTGCTGGCTGCCGTATCCCCGGACTCGCCCTGTGGCGACGATCTGGAGTACGACGCCGCGTTCCTCGAAC
TCGAACGCATCGCCCAGGGCCAACCCGAGCGCCAGATGGGCGATGCCGTGCTGCCCGCCGAACCGCCGGA
GTGGCCGCGCGTACGCGCGCTGGCCAGCGAACTGTTCGGCCGTAGCAAGGACCTGCGGGTAGCCAACCTG
CTGCTGCAGAGCAACGTCGCCCTCGACGGCCTGGACGGACTCGCCGACGGCCTGCTGCTGGTCCGCGAGC
TGCTCGGCCAGTACTGGGACGGCGTCTATCCGCTGCTCGACGCCGATGACGACAACGACCCCACCTTCCG
TATCAACGCCCTCACCGGCCTGGTCGCCGAACCGCTGCTGCAACTGGTCTGGGCGATCCCGCTGGTGCGC
TCGCGGGCGTTCGGCCCGGTCAACCTGCGCGCCGCGCTGAACGCCGCCGGGCTGCAACGCTTCGCCAGCG
AGACCCTGAGTCCCGAGCAGATCGCCGGCGCCTTCGCCGATGCCGACGCCGATGCGCTGGCCGCCACCCG
GCGCGCCCTGGAAGGCGCCCAGGAACATGCCCTGGCCATCGAGAGCGGCGTCGCCGAACGGGTCGGCTCG
GCCCAGGGACTCGACCTCGGTCCCCTTCGTCAACTGCTGCGCCAGGCCCTCCAGGTGTTCGACCTGTACG
GCCCGCAGGGCGCCGGCGAGCCCTTGGCGCCGGGCGCCGAAGCGGCCGCCGACGAGCAGGGGGGCGCCGC
GCCTGTCGCAGCCGTCGCCGCGCCGGCACCGCGAGCCAGCGGCGAGATCGCCAACCGCGAAGACGTCCTG
CGCCAGCTCGACCGCCTGCTCGAGTATTACGTTCGCCACGAGCCGTCGAGCCCGGTGCCGGTGCTGCTCA
AGCGCGCCAAGACACTGGTGACGGCCGACTTCGCCGAAATCGTGAGGAATCTCATCCCCGATGGGATTTC
CCAGTTCGAAACCCTGCGAGGCCCGGAAAGCGAGTAA