SecReT6
Protein ID: 392981497
SecReT6 ID674
T6SS typei3
Gene symbol-
Locus tagPADK2_00435
StrainPseudomonas aeruginosa DK2
Repliconchromosome [GenBank: NC_018080] [Browse all T6SS(s) in this replicon]
Location [Strand]100409..100927 [+]
Producthypothetical protein
NoteTssB
UniProt IDI6RER6
KEGG IDpdk:PADK2_00435
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.60E-60, Aligned region: 11..164
Protein Sequence: 172 a.a.     [Download]
>gi|392981497|ref|YP_006480084.1| hypothetical protein PADK2_00435 [Pseudomonas aeruginosa DK2]
MGSTTSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVMADLAGKPAEPQAAVADRKFLEIDVDNF
DARLKAMKPRVAFNVPNVLTGEGNLSLDITFESMDDFSPAAVARKVDSLNKLLEARTQLANLLTYMDGKT
GAEEMIMKAIKDPALLQALASAPKPKDDEPQA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|392981410|ref|NC_018080.1|:100409-100927 Pseudomonas aeruginosa DK2 chromosome, complete genome
ATGGGAAGCACTACCAGCAGTCAGAAGTTCATCGCCAGGAACCGGGCGCCACGCGTGCAGATCGAGTACG
ACGTGGAGTTGTACGGTGCCGAGAAGAAGGTCCAGCTGCCCTTCGTCATGGGCGTCATGGCCGACCTCGC
CGGCAAGCCCGCCGAACCCCAGGCGGCGGTCGCCGACCGCAAGTTCCTGGAGATCGACGTGGACAACTTC
GATGCCCGGCTGAAGGCGATGAAGCCGCGGGTGGCCTTCAACGTACCGAACGTGCTGACCGGCGAAGGCA
ACCTGAGCCTGGACATCACCTTCGAGAGCATGGACGACTTCAGCCCCGCCGCGGTGGCGCGCAAGGTCGA
TTCGCTGAACAAGCTGCTCGAGGCGCGTACCCAGCTGGCCAACCTGCTGACCTACATGGACGGCAAGACC
GGCGCCGAGGAAATGATCATGAAGGCGATCAAGGACCCGGCCCTGCTTCAGGCCCTGGCCAGCGCGCCGA
AGCCCAAAGACGACGAGCCGCAGGCGTAA